Difference between revisions of "Os01g0112400"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 play a role in response to heat stress.
 
Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 play a role in response to heat stress.
 +
 
In the rice genome, transporter family genes are grouped into 4 distinct types: ATP-dependent transporters, secondary transporters, ion channels, and unclassified transporters. As a gene related to sugar, peptide, amino acid and other metabolites transport,most genes are heat-induced or identified as HR genes. While OsTIP4;1(Os01g0112400) and OsTIP4;1(Os05g0231700) were continuously late elevated during heating in rice panicle . the reason is still unknown.
 
In the rice genome, transporter family genes are grouped into 4 distinct types: ATP-dependent transporters, secondary transporters, ion channels, and unclassified transporters. As a gene related to sugar, peptide, amino acid and other metabolites transport,most genes are heat-induced or identified as HR genes. While OsTIP4;1(Os01g0112400) and OsTIP4;1(Os05g0231700) were continuously late elevated during heating in rice panicle . the reason is still unknown.
  

Revision as of 05:19, 26 May 2014

Please input one-sentence summary here.

Annotated Information

Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 play a role in response to heat stress.

In the rice genome, transporter family genes are grouped into 4 distinct types: ATP-dependent transporters, secondary transporters, ion channels, and unclassified transporters. As a gene related to sugar, peptide, amino acid and other metabolites transport,most genes are heat-induced or identified as HR genes. While OsTIP4;1(Os01g0112400) and OsTIP4;1(Os05g0231700) were continuously late elevated during heating in rice panicle . the reason is still unknown.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0112400

Description

Major intrinsic protein family protein

Version

NM_001048348.1 GI:115434109 GeneID:4326119

Length

1125 bp

Definition

Oryza sativa Japonica Group Os01g0112400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:644598..645722

Sequence Coding Region

644732..645418,645524..645697

Expression

GEO Profiles:Os01g0112400

Genome Context

<gbrowseImage1> name=NC_008394:644598..645722 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:644598..645722 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgacaacggatcatgccgggaagaaagtcgacgtcgtcgtggttggcaacgttgacggcgagcacgtcggagtagagcaagctcgccatgatctgcacgaggaggcggcggcggcggcggcggctgaccatcatgccaccagaggcctagccattggctttctcatacgagaggtgatggtggaggggttggcgtcgttcttggtggtgttctggtcgtgcgtggcggcgctgatgcaggagatgtacgggacgctgacgttcccgatggtgtgcctggtggtggcgatgacggtggcgttcgttctcagctggctcggcccggcgcacttcaacccggccgtcaccatcaccttcgccgcctaccgccgcttcccggtctggcccaagctgccgctctacgtcgccgcccagctcgccggctcgctcctcgcctgcctctccgtcaacgccgtcatgaggccgcgccacgaccacttctacggcacggcgcccgtcgtcgtccacggcacccgcctccccttcctcatggagttcctcgcctccgccgtcctcatgatcgtcatcgccaccgtcgccaccgacggcacagcggggaagacggtgggagggatcgccatcggagcggcggtgggagggctggggctggtgatcgggccggtgtcgggagggtcgatgaacccggcgaggacgctggggccggcgatcgtgctgggcaggtacgacggcgtgtggatctacgtggtggcgcccgtcgccgggatgctggtcggcgcgctctgcaaccgcgccgtcaggctctcccaccgcatcgtcgccttcctctgcggcacctctgttgggatcgccggctcgccctag</cdnaseq>

Protein Sequence

<aaseq>MTTDHAGKKVDVVVVGNVDGEHVGVEQARHDLHEEAAAAAAADH HATRGLAIGFLIREVMVEGLASFLVVFWSCVAALMQEMYGTLTFPMVCLVVAMTVAFV LSWLGPAHFNPAVTITFAAYRRFPVWPKLPLYVAAQLAGSLLACLSVNAVMRPRHDHF YGTAPVVVHGTRLPFLMEFLASAVLMIVIATVATDGTAGKTVGGIAIGAAVGGLGLVI GPVSGGSMNPARTLGPAIVLGRYDGVWIYVVAPVAGMLVGALCNRAVRLSHRIVAFLC GTSVGIAGSP</aaseq>

Gene Sequence

<dnaseqindica>305..991#26..199#gaatgagatactaattaatactgaaatgacaacggatcatgccgggaagaaagtcgacgtcgtcgtggttggcaacgttgacggcgagcacgtcggagtagagcaagctcgccatgatctgcacgaggaggcggcggcggcggcggcggctgaccatcatgccaccagaggcctagccattggctttctcatacgagaggtaggtacatataatgtctgcaaatttatgattaattgatacacataaaaccctttgcatgaattgaattgaaccgatgaatggatggcaatggcgatggagcaggtgatggtggaggggttggcgtcgttcttggtggtgttctggtcgtgcgtggcggcgctgatgcaggagatgtacgggacgctgacgttcccgatggtgtgcctggtggtggcgatgacggtggcgttcgttctcagctggctcggcccggcgcacttcaacccggccgtcaccatcaccttcgccgcctaccgccgcttcccggtctggcccaagctgccgctctacgtcgccgcccagctcgccggctcgctcctcgcctgcctctccgtcaacgccgtcatgaggccgcgccacgaccacttctacggcacggcgcccgtcgtcgtccacggcacccgcctccccttcctcatggagttcctcgcctccgccgtcctcatgatcgtcatcgccaccgtcgccaccgacggcacagcggggaagacggtgggagggatcgccatcggagcggcggtgggagggctggggctggtgatcgggccggtgtcgggagggtcgatgaacccggcgaggacgctggggccggcgatcgtgctgggcaggtacgacggcgtgtggatctacgtggtggcgcccgtcgccgggatgctggtcggcgcgctctgcaaccgcgccgtcaggctctcccaccgcatcgtcgccttcctctgcggcacctctgttgggatcgccggctcgccctagctaccacactagagcttagccctccatatatatatccacagaataattcgcctccattatgatagctgcatgaacacgacgagcatcgctgcactgaaattgttttggaccaaccaatagagattttccatccc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0112400, RefSeq:Os01g0112400