Difference between revisions of "Os01g0112400"
(→Evolution) |
(→Annotated Information) |
||
| Line 2: | Line 2: | ||
==Annotated Information== | ==Annotated Information== | ||
| − | Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 | + | Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 plays a role in response to heat stress. |
| + | |||
| + | ==Function== | ||
In the rice genome, transporter family genes are grouped into 4 distinct types: ATP-dependent transporters, secondary transporters, ion channels, and unclassified transporters. As a gene related to sugar, peptide, amino acid and other metabolites transport,most genes are heat-induced or identified as HR genes. While OsTIP4;1(Os01g0112400) and OsTIP4;1(Os05g0231700) were continuously late elevated during heating in rice panicle . the reason is still unknown. | In the rice genome, transporter family genes are grouped into 4 distinct types: ATP-dependent transporters, secondary transporters, ion channels, and unclassified transporters. As a gene related to sugar, peptide, amino acid and other metabolites transport,most genes are heat-induced or identified as HR genes. While OsTIP4;1(Os01g0112400) and OsTIP4;1(Os05g0231700) were continuously late elevated during heating in rice panicle . the reason is still unknown. | ||
| − | === | + | |
| − | + | ===Laboratory=== | |
| + | |||
Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University, Changsha, China | Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University, Changsha, China | ||
| Line 13: | Line 16: | ||
College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, China | College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, China | ||
| + | ===Research articles=== | ||
Xianwen Zhang, Jiaping Li, Ailing Liu et al.Expression Profile in Rice Panicle: Insights into Heat Response Mechanism at Reproductive Stage[J]PLOS. ONE 2012 | Xianwen Zhang, Jiaping Li, Ailing Liu et al.Expression Profile in Rice Panicle: Insights into Heat Response Mechanism at Reproductive Stage[J]PLOS. ONE 2012 | ||
http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0049652#pone-0049652-g010 | http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0049652#pone-0049652-g010 | ||
Revision as of 13:17, 4 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 plays a role in response to heat stress.
Function
In the rice genome, transporter family genes are grouped into 4 distinct types: ATP-dependent transporters, secondary transporters, ion channels, and unclassified transporters. As a gene related to sugar, peptide, amino acid and other metabolites transport,most genes are heat-induced or identified as HR genes. While OsTIP4;1(Os01g0112400) and OsTIP4;1(Os05g0231700) were continuously late elevated during heating in rice panicle . the reason is still unknown.
Laboratory
Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University, Changsha, China
College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, China
Research articles
Xianwen Zhang, Jiaping Li, Ailing Liu et al.Expression Profile in Rice Panicle: Insights into Heat Response Mechanism at Reproductive Stage[J]PLOS. ONE 2012 http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0049652#pone-0049652-g010
Structured Information
| Gene Name |
Os01g0112400 |
|---|---|
| Description |
Major intrinsic protein family protein |
| Version |
NM_001048348.1 GI:115434109 GeneID:4326119 |
| Length |
1125 bp |
| Definition |
Oryza sativa Japonica Group Os01g0112400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:644598..645722 |
| Sequence Coding Region |
644732..645418,645524..645697 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:644598..645722 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:644598..645722 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgacaacggatcatgccgggaagaaagtcgacgtcgtcgtggttggcaacgttgacggcgagcacgtcggagtagagcaagctcgccatgatctgcacgaggaggcggcggcggcggcggcggctgaccatcatgccaccagaggcctagccattggctttctcatacgagaggtgatggtggaggggttggcgtcgttcttggtggtgttctggtcgtgcgtggcggcgctgatgcaggagatgtacgggacgctgacgttcccgatggtgtgcctggtggtggcgatgacggtggcgttcgttctcagctggctcggcccggcgcacttcaacccggccgtcaccatcaccttcgccgcctaccgccgcttcccggtctggcccaagctgccgctctacgtcgccgcccagctcgccggctcgctcctcgcctgcctctccgtcaacgccgtcatgaggccgcgccacgaccacttctacggcacggcgcccgtcgtcgtccacggcacccgcctccccttcctcatggagttcctcgcctccgccgtcctcatgatcgtcatcgccaccgtcgccaccgacggcacagcggggaagacggtgggagggatcgccatcggagcggcggtgggagggctggggctggtgatcgggccggtgtcgggagggtcgatgaacccggcgaggacgctggggccggcgatcgtgctgggcaggtacgacggcgtgtggatctacgtggtggcgcccgtcgccgggatgctggtcggcgcgctctgcaaccgcgccgtcaggctctcccaccgcatcgtcgccttcctctgcggcacctctgttgggatcgccggctcgccctag</cdnaseq> |
| Protein Sequence |
<aaseq>MTTDHAGKKVDVVVVGNVDGEHVGVEQARHDLHEEAAAAAAADH HATRGLAIGFLIREVMVEGLASFLVVFWSCVAALMQEMYGTLTFPMVCLVVAMTVAFV LSWLGPAHFNPAVTITFAAYRRFPVWPKLPLYVAAQLAGSLLACLSVNAVMRPRHDHF YGTAPVVVHGTRLPFLMEFLASAVLMIVIATVATDGTAGKTVGGIAIGAAVGGLGLVI GPVSGGSMNPARTLGPAIVLGRYDGVWIYVVAPVAGMLVGALCNRAVRLSHRIVAFLC GTSVGIAGSP</aaseq> |
| Gene Sequence |
<dnaseqindica>305..991#26..199#gaatgagatactaattaatactgaaatgacaacggatcatgccgggaagaaagtcgacgtcgtcgtggttggcaacgttgacggcgagcacgtcggagtagagcaagctcgccatgatctgcacgaggaggcggcggcggcggcggcggctgaccatcatgccaccagaggcctagccattggctttctcatacgagaggtaggtacatataatgtctgcaaatttatgattaattgatacacataaaaccctttgcatgaattgaattgaaccgatgaatggatggcaatggcgatggagcaggtgatggtggaggggttggcgtcgttcttggtggtgttctggtcgtgcgtggcggcgctgatgcaggagatgtacgggacgctgacgttcccgatggtgtgcctggtggtggcgatgacggtggcgttcgttctcagctggctcggcccggcgcacttcaacccggccgtcaccatcaccttcgccgcctaccgccgcttcccggtctggcccaagctgccgctctacgtcgccgcccagctcgccggctcgctcctcgcctgcctctccgtcaacgccgtcatgaggccgcgccacgaccacttctacggcacggcgcccgtcgtcgtccacggcacccgcctccccttcctcatggagttcctcgcctccgccgtcctcatgatcgtcatcgccaccgtcgccaccgacggcacagcggggaagacggtgggagggatcgccatcggagcggcggtgggagggctggggctggtgatcgggccggtgtcgggagggtcgatgaacccggcgaggacgctggggccggcgatcgtgctgggcaggtacgacggcgtgtggatctacgtggtggcgcccgtcgccgggatgctggtcggcgcgctctgcaaccgcgccgtcaggctctcccaccgcatcgtcgccttcctctgcggcacctctgttgggatcgccggctcgccctagctaccacactagagcttagccctccatatatatatccacagaataattcgcctccattatgatagctgcatgaacacgacgagcatcgctgcactgaaattgttttggaccaaccaatagagattttccatccc</dnaseqindica> |
| External Link(s) |
