Difference between revisions of "Os01g0273800"

From RiceWiki
Jump to: navigation, search
(Expression)
(Expression)
Line 16: Line 16:
 
===Expression===
 
===Expression===
 
The expression of OsYUC9 is localized primarily in the endosperm. In the developing grains, OsYUC9 is co-expressed with OsTAR1 both temporally and spatially. Analysis of gene co-expressiong between TAA/TAR, endosperm related YUCCAs and OsTDC1 and its orthologues.OsYUC9 is always co-expressed gene.The table bellow was downloaded via PLEXdb (http://www.plexdb.org) , and it is about RMA nomalized expression data from reproductive tissue in microarray expriments OS5, OS32, OS8 (rice), AT40 (Arabidopsis thaliana) and ME1 (Medicago truncatula), the pearson correlation coefficient (r) and slope were calculated in Excel and used to derive the statistical significance of the correlation[1].
 
The expression of OsYUC9 is localized primarily in the endosperm. In the developing grains, OsYUC9 is co-expressed with OsTAR1 both temporally and spatially. Analysis of gene co-expressiong between TAA/TAR, endosperm related YUCCAs and OsTDC1 and its orthologues.OsYUC9 is always co-expressed gene.The table bellow was downloaded via PLEXdb (http://www.plexdb.org) , and it is about RMA nomalized expression data from reproductive tissue in microarray expriments OS5, OS32, OS8 (rice), AT40 (Arabidopsis thaliana) and ME1 (Medicago truncatula), the pearson correlation coefficient (r) and slope were calculated in Excel and used to derive the statistical significance of the correlation[1].
 +
 +
[[File:QQ图片20140526235702.jpg]]
  
 
===Evolution===
 
===Evolution===

Revision as of 16:11, 26 May 2014

Please input one-sentence summary here.

Annotated Information

Function

IAA(indole-3-acetic acid)is important during starch deposition in addition to its previously suggested role early in grain development. OsYUC9, is a kind of IAA biosynthesis gene. OsYUC9 and its encoded enzymes may have a role in the starch deposition phase in rice grains.

Gene type

protein coding

General protein information

Names:hypothetical protein


FAD dependent oxidoreductase family protein~contains InterPro domain(s): IPR013027, IPR000103, IPR000960, IPR006076, IPR000205~has GO asignment(s): GO:0004497, GO:0006118, GO:0016491~supported by AK109645


Expression

The expression of OsYUC9 is localized primarily in the endosperm. In the developing grains, OsYUC9 is co-expressed with OsTAR1 both temporally and spatially. Analysis of gene co-expressiong between TAA/TAR, endosperm related YUCCAs and OsTDC1 and its orthologues.OsYUC9 is always co-expressed gene.The table bellow was downloaded via PLEXdb (http://www.plexdb.org) , and it is about RMA nomalized expression data from reproductive tissue in microarray expriments OS5, OS32, OS8 (rice), AT40 (Arabidopsis thaliana) and ME1 (Medicago truncatula), the pearson correlation coefficient (r) and slope were calculated in Excel and used to derive the statistical significance of the correlation[1].

QQ图片20140526235702.jpg

Evolution

Yxm.jpg

Labs working on this gene


1、Molecular and Cellular Biology, University of New England, Armidale, New South Wales, Australia


2、Department of Biochemistry and Molecular Biology, University of Massachusetts, Amherst, MA 01003,USA


References

1、Yousef M. Abu-Zaitoon, Karina Benett, Jennifer Normanly and Heather M. Nonhebel(2012), A large increase in IAA during development of rice grains correlates with the expressing of tryptophan aminotransferase OsTAR1 and a grain-specific YUCCA, Physiologia Plantarum 146:487-499


2、Edgar RC(2004)MUSCLE: multiple sequence alignment with high accuracy and high throughput. Nucleic Acids Res 32:1792-1797


3、Felsenstein J(1989)PHYLIP-Phylogeny Inference Package(Version 3.2). Cladistics 5:164-166


4、Information from NCBI: [1]

Structured Information

Gene Name

Os01g0273800

Description

FAD dependent oxidoreductase family protein

Version

NM_001049251.1 GI:115435915 GeneID:4325177

Length

5140 bp

Definition

Oryza sativa Japonica Group Os01g0273800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:9487781..9492920

Sequence Coding Region

9487815..9488447,9491586..9491945,9492564..9492767

Expression

GEO Profiles:Os01g0273800

Genome Context

<gbrowseImage1> name=NC_008394:9487781..9492920 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:9487781..9492920 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggcggtggagcaggatcaggaggaggaggtgatcatcgtcggggcggggccgtcggggctcgcggcggcggcgtgcctgtcggtgcgcggcgtgacgggctgcctcgtcctggagcgcgacgactgcgtggcgtcgctgtggcgccaccgcacctacgaccgcgtccgcctccacctcgccaagcgctactgcgcgctcccgcacgcgccgcacggcgaggcgtcgccgacctacctcccccgcgacgacttcctccgctacctcgacgcctacgcctcccgcttcggcgtccgcgcccgcctccgccgcgaggtccgctcggcgcgctacgacgccgcccgcgcccggtggctcgtcgacgccgtcgacctcgccacgggacgcgcggagcggtacgcggcgaggcacctggtcgccgccgcgggcgagaacgacgagagggtggtgcccgaggtgcccgggatggagacgttccccgggaaggtggtgcacgccgccgactaccggagcgcggaggggttcaaggggaagtccgtgctcgtcgtcggcggcggcaactccggcatggagatcgcctacgacctcgccgtcggcggcgccgccacctccatcgtcatccgcagcgagctgcacctggtgagcaaggagatatggaacttggcgatgacgctgtacaggtacctgccggtgtgggtgatcgacaaggtggtgctgctcatgtgcgccgccgtgttcggcgacaccgcccgctacggcctccggcggccggccgtcgggcccttcaccatgaaggccaccaccacgatgtacccggtcgtggacgtcggcaccttcgccaagatcaggtccggcgagatccgcgtcctcccggccgccatcaagggcgtccgcggccgcgacgtcgagttcgccgacggccagcgccacgccttcgacgccgtcgtcttcgccaccggctaccggagcaccaccaagcactggctcaagagtgatgacgggctgatcggcgacgacgggatggcggggcggagctacccggatcactggaagggggagaacgggctgtactgcgccgggatggtgaggaggggaatctacggcagctacgaggacgcggagcacatcgccgacgacatcagcaagcaactccggagcagcagcaagcctacccacaacaatggctcggcctag</cdnaseq>

Protein Sequence

<aaseq>MAAVEQDQEEEVIIVGAGPSGLAAAACLSVRGVTGCLVLERDDC VASLWRHRTYDRVRLHLAKRYCALPHAPHGEASPTYLPRDDFLRYLDAYASRFGVRAR LRREVRSARYDAARARWLVDAVDLATGRAERYAARHLVAAAGENDERVVPEVPGMETF PGKVVHAADYRSAEGFKGKSVLVVGGGNSGMEIAYDLAVGGAATSIVIRSELHLVSKE IWNLAMTLYRYLPVWVIDKVVLLMCAAVFGDTARYGLRRPAVGPFTMKATTTMYPVVD VGTFAKIRSGEIRVLPAAIKGVRGRDVEFADGQRHAFDAVVFATGYRSTTKHWLKSDD GLIGDDGMAGRSYPDHWKGENGLYCAGMVRRGIYGSYEDAEHIADDISKQLRSSSKPT HNNGSA</aaseq>

Gene Sequence

<dnaseqindica>35..667#3806..4165#4784..4987#acctctctctcgattcaccacggcggcgacggcaatggcggcggtggagcaggatcaggaggaggaggtgatcatcgtcggggcggggccgtcggggctcgcggcggcggcgtgcctgtcggtgcgcggcgtgacgggctgcctcgtcctggagcgcgacgactgcgtggcgtcgctgtggcgccaccgcacctacgaccgcgtccgcctccacctcgccaagcgctactgcgcgctcccgcacgcgccgcacggcgaggcgtcgccgacctacctcccccgcgacgacttcctccgctacctcgacgcctacgcctcccgcttcggcgtccgcgcccgcctccgccgcgaggtccgctcggcgcgctacgacgccgcccgcgcccggtggctcgtcgacgccgtcgacctcgccacgggacgcgcggagcggtacgcggcgaggcacctggtcgccgccgcgggcgagaacgacgagagggtggtgcccgaggtgcccgggatggagacgttccccgggaaggtggtgcacgccgccgactaccggagcgcggaggggttcaaggggaagtccgtgctcgtcgtcggcggcggcaactccggcatggagatcgcctacgacctcgccgtcggcggcgccgccacctccatcgtcatccgcagcgaggtcagctagcttgcttagctcttgtctcctatactagcttaattataattaattcgtttcaatcgtttccaaattaaattcgatttgccattaaaacgagcgaatttcaagctctgtttatttgtccctcgtttaatttgcttataattaattatttttgatttaccaattaattaatcgaatttgtaccttaaaaaaattatacgaccgaatcgaatatttggtactagtataattgttatttgaccaaatttggtagggccgggccaattaataacatcctagccaccttaaaagagctagatttgccaataattttcgtaacattcttattatttgctagtataccaacccctggccccacacgctagtgagaatgagaaaagctattttttttttgtattttctttggtaccaattaatccatggccccacatgccagtgagtgagagtacccgtgcttgatcagttgatcggtgaggaagtaccttgaattaatttacgaccatcggatcgcctaacggacggctaggatcgagtaatcaagctgagtaattaattaaccataattagttactgacagagatcttaaagagggattaattagcagtggacgcggcgggctcctgaccgtgattaagctctgtaattaattaaaaccatccacgttttcttcctttccaatggatcgatcagtacatgtggttattaatcaccagggttaattacttcattactccctagtgttgctggtactacgtagtagtagcgattaattaagacatgacgacgcaacagtccaaattctttcagtgtggtcctaagctaccatcagtactgatgaaacatgacaaatagagaaactccaactaactttgaaatgaaacaaaaaaacacacgtacggagatcgaaattgatccccaaacaccaacattacaggtttacattaatggtctatatgaaaaaaaattaaaaaagagacagagtataatatgccaataaattcggtgaatagaaggtgtgaccacaaataagacgacgtatatttaattaggacatgggacgtatttagaacagaaataaccacacaatctattcaatggtaaaatgtgtacccacgccgctatatatataaggttaattagtccttaatttagtctctttagactgtgctagctagaatataatcatgtacaggtgtttgtaggcgtgagtaattaagtgtgtgcatcctgacgtgtattttgggcaaccaacatgaaagctgtttttttttttaaaacttgggctctttaattccagaggactcgaaagtggaaataaattaaacaattaaaccaacaacctggcagagaatttcgttgctgtatgattaattacagtagtgtgcatgcttattgcaaattttattagacccaaccatataaaatggtatccgagagctatatcgtgggcggcgccatgtaaaagtataaataacttgactatatatatatatatatatatatatatatatatatatatatatatatatatatatatatatattcatcgtcgctggcacatggcctggtctctctcgaactctgacatcacgtgcaggcaaattaaacacatcatcgatcgatcagactacacaatgattttgctcctaattaatctcagccggagaccgcagctgattaaatgcgtaatgtaattcaggtcaggttgcatgcatgcagcataggatccgatgattattttgcttaaaaacatcattaactcgattgttatcaatcacatcacaagcatatatatgtggctcgatccagtatacgtacgttcatctctctgtatgtatgtcgtacgtatatactgtaccgtacgtgcgtcatcgtcatcaggagggaaaaaaacacgttacacgtgcacgcctttgtctgattttcgcatggcgacgccagatccacgcaggcatatcatagtccgtccagcgtccctccggacggcctgggatcctgtcctctagtattttcttgttccaattattaggggagccctctatttgcggctctatttgattcgggctaaatataactatacgtagacagaaagttattcctccctccattctaaaatataagatataactaccattaacccaaaaactaagaaataattattatcgcatcgtagtttagattaccctaataaatagaatacatgcacccaataaaattagagatcttgttgatggaggatttaaataatattattataataaaaaaagatgggctagttaatgacatacatgcatatacgccttatattatgaaataacttgaaacaactttaaaaattagttacgccttatattatggaatggagggagtatatctctacttatttaaatgtagtgtggttatccttcttttttttttccttcttaccgtgtgccaaaagtcgtacggtccttcgtgtgtgcgtaattaccgtaggatctagtttcagagatgtcagtaataatatcattaattaattaaaatttttaatgtaactagtctttgattaatcactatacatctgttggtttagacatcaacacaacgttctataatatccatggaactagcatattgaccgtgcgttgtaacgtgattttaatcaaataaaaaattatcactaagatgttattatcatctcttaattgatgtatatatatttgttactgacatatgaatcctttagtactacactattacttttccttcttataaaaaacatatagttggtgggagtggttgacatataggtcctctagacccacatgccatttttgctaaaaagaaaagttaggagttggtggggggtcggtggcggaacaagaaccaccactactcgagtatagataaacttttttttaaaaaataaaaatataattatatgaaagagctttttatgaaaaatctattaatataaaatttcattttgattttttaaaatattttaatatttagtaatgatttaagatttcgagattttttctacacgcataactgtagtacgtcgtccttactccttagcgaggtaatctcagtgaccattctggttaatcatgcaatctaaattgcaaccaattaattaatcgatcgcagctgcacctggtgagcaaggagatatggaacttggcgatgacgctgtacaggtacctgccggtgtgggtgatcgacaaggtggtgctgctcatgtgcgccgccgtgttcggcgacaccgcccgctacggcctccggcggccggccgtcgggcccttcaccatgaaggccaccaccacgatgtacccggtcgtggacgtcggcaccttcgccaagatcaggtccggcgagatccgcgtcctcccggccgccatcaagggcgtccgcggccgcgacgtcgagttcgccgacggccagcgccacgccttcgacgccgtcgtcttcgccaccggctaccggagcaccaccaagcactggctcaaggtaattgtaattaattaataagttaattaattgaacagtactgtgttaattgtttgcatcatgattcgtacgtgcggcgacacaattaattattgctgctcccggccgtatgcatattcctatttggaaaagtctgaggctttggcatgaagcaaagctcgacaaggtctcaactttcagcagcatacacctcatgctgaacgtacatactgatccgtctcgtaatataaagtattttttgatggatgtgacacatcctaatataatatttgtccagattaattaaatcaggatgtgttacatctatccaaaatcccttatattatgagacgaggtagtacatgtttttcgaataatatatcagcgatagctagtgtggcttatgacaacatttttttttcaatccgaaacacacaaaagctttacatgttatttaaccatcaacaataaaagctctaatatttttgtttttttaaaaaacagaatggcacattaaaaatcatgttttaattaaccttattgtacgatcttaactatgccatatgctagatagtaccttatttatatattttacatatgttttctaacatttgtgtgtaattaaatttaattttatagagtgatgacgggctgatcggcgacgacgggatggcggggcggagctacccggatcactggaagggggagaacgggctgtactgcgccgggatggtgaggaggggaatctacggcagctacgaggacgcggagcacatcgccgacgacatcagcaagcaactccggagcagcagcaagcctacccacaacaatggctcggcctagaaagaaattaaatcaagctgatgaggctctcccccttggaccttgtcttggttattatattaggtgtagcttttatactatgattttgtttctgagtttgtggatgtggatgaaataaacaaaataaaacttgcccttgggtggtctttgatt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0273800, RefSeq:Os01g0273800