Difference between revisions of "Os02g0731200"

From RiceWiki
Jump to: navigation, search
(Expression)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
 +
 
Transcription factors of the MADS-domain family(named for yeast MCM1, plant AGAMOUS and DEFICIENS, and mammal Serum Response Factor) are highly conserved among fungi, animals and plants. In plants, MADS-box family are key regulators of flowering, floral organ identity and development, embryogenesis and meristem differentiation. In rice, most genes of MADS-box family are involved in reproductive growth, whereas AGL17-like clade genes may have a unique function in vegetative development.
 
Transcription factors of the MADS-domain family(named for yeast MCM1, plant AGAMOUS and DEFICIENS, and mammal Serum Response Factor) are highly conserved among fungi, animals and plants. In plants, MADS-box family are key regulators of flowering, floral organ identity and development, embryogenesis and meristem differentiation. In rice, most genes of MADS-box family are involved in reproductive growth, whereas AGL17-like clade genes may have a unique function in vegetative development.
OsMADS57 is one of AGL17-like clade genes. This gene play a important role in the differentiation of axillary buds. The osmads57-1 mutant has increased number of tillers. D14 that functions in strigolactone(SL) sigalling to control tillering is a direct target gene of OsMADS57. OsMADS57 is negatively regulated by OsmiR444a, and OsMADS57 subsequently repress expression of its target genes, thereby affecting tillering. OsMADS57 could interacted directly with OsTB1, and this interaction could partially the relieve the inhibitory effect of OsMADS57 on D14 transcription.  
+
 
 +
OsMADS57 is one of AGL17-like clade genes. This gene play a important role in the differentiation of axillary buds. The osmads57-1 mutant has increased number of tillers. D14 that functions in strigolactone(SL) sigalling to control tillering is a direct target gene of OsMADS57. OsMADS57 is negatively regulated by OsmiR444a, and OsMADS57 subsequently repress expression of its target genes, thereby affecting tillering. OsMADS57 could interacted directly with OsTB1, and this interaction could partially the relieve the inhibitory effect of OsMADS57 on D14 transcription <ref name="ref1" />.  
 +
 
 
In a word, in rice, miR444a, MADS57, D14 and TB1 form a regulatory network to control tillering.
 
In a word, in rice, miR444a, MADS57, D14 and TB1 form a regulatory network to control tillering.
  

Revision as of 10:20, 27 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Transcription factors of the MADS-domain family(named for yeast MCM1, plant AGAMOUS and DEFICIENS, and mammal Serum Response Factor) are highly conserved among fungi, animals and plants. In plants, MADS-box family are key regulators of flowering, floral organ identity and development, embryogenesis and meristem differentiation. In rice, most genes of MADS-box family are involved in reproductive growth, whereas AGL17-like clade genes may have a unique function in vegetative development.

OsMADS57 is one of AGL17-like clade genes. This gene play a important role in the differentiation of axillary buds. The osmads57-1 mutant has increased number of tillers. D14 that functions in strigolactone(SL) sigalling to control tillering is a direct target gene of OsMADS57. OsMADS57 is negatively regulated by OsmiR444a, and OsMADS57 subsequently repress expression of its target genes, thereby affecting tillering. OsMADS57 could interacted directly with OsTB1, and this interaction could partially the relieve the inhibitory effect of OsMADS57 on D14 transcription [1].

In a word, in rice, miR444a, MADS57, D14 and TB1 form a regulatory network to control tillering.

Expression

OsMADS57 expression is higher during tillering and stem-elongation stages than other stages in rice. It is highly expressed in leaf tissues especially sheaths and leaves, and weakly expressed in other organs.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0731200

Description

Transcription factor MADS57

Version

NM_001054553.1 GI:115448476 GeneID:4330621

Length

5472 bp

Definition

Oryza sativa Japonica Group Os02g0731200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:31343861..31349332

Sequence Coding Region

31343861..31344042,31345205..31345280,31348037..31348098,31348534..31348633,31348722..31348763
,31348863..31348946,31349030..31349193,31349281..31349296

Expression

GEO Profiles:Os02g0731200

Genome Context

<gbrowseImage1> name=NC_008395:31343861..31349332 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:31343861..31349332 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggagggggaagatagtgataaggaggatagacaactcgacgagcaggcaggtgacgttctcgaagcgtcggaacgggcttctgaagaaggcgaaggagctatccatcctctgcgatgcggaggtcggccttgtcgtcttctccagcaccggcaggctctatgagttctccagcaccaacatgaaaactgtgatagaccggtataccaacgcaaaggaggagctacttggcgggaatgcaacttcagaaattaagatttggcagagggaggcagcaagcttgaggcagcaactgcacaacttgcaagaaagccacaagcaactgatgggtgaggagctttctggcctaggtgttagagacctacaaggtttagagaataggcttgaaataagtctacgtaatatcagaatgagaaaggacaatcttttgaaaagtgaaatcgaggagttacatgtgaagggaagcctaattcaccaggaaaacatcgaactttctagaagcctaaatgtcatgtcgcaacaaaaattggaactgtataacaagcttcaggcctgtgaacagagaggtgccacagatgcaaatgaaagttccagcactccatacagctttcgtatcatacaaaatgctaatatgcctcctagtcttgaattgagccaatcacagcaaagagaaggggagtgcagcaaaacagctgctccagaactgggacttcatctgccttaa</cdnaseq>

Protein Sequence

<aaseq>MGRGKIVIRRIDNSTSRQVTFSKRRNGLLKKAKELSILCDAEVG LVVFSSTGRLYEFSSTNMKTVIDRYTNAKEELLGGNATSEIKIWQREAASLRQQLHNL QESHKQLMGEELSGLGVRDLQGLENRLEISLRNIRMRKDNLLKSEIEELHVKGSLIHQ ENIELSRSLNVMSQQKLELYNKLQACEQRGATDANESSSTPYSFRIIQNANMPPSLEL SQSQQREGECSKTAAPELGLHLP</aaseq>

Gene Sequence

<dnaseqindica>1..182#1345..1420#4177..4238#4674..4773#4862..4903#5003..5086#5170..5333#5421..5436#atggggagggggaagatagtgataaggaggatagacaactcgacgagcaggcaggtgacgttctcgaagcgtcggaacgggcttctgaagaaggcgaaggagctatccatcctctgcgatgcggaggtcggccttgtcgtcttctccagcaccggcaggctctatgagttctccagcaccaagtaagcaatccatcggatttataagtatatatgtatatttcccctaatttaattgtagtttccttagttgttctcggatctgctttgaagtctccttttgttcttgatttatttttgaaagaactctccttgttctttcacttgataggtatatatatctggttctggtaatctttcatccttttaagtttgagacgtttttatcaacaaaatgacccaagtatatgtctgatcagcttttcatcctttcaagttttgaggcatttttatcaacacaaagacccaagctaagcatatatgtatgcatggctattagtcattcttgtgatcttttagtaagctatagctacatagcaatcaatatgtatgcatatagtgtcagtttaattgtgatattttccctccgttctcgaaaacaattgacacttggcactactaagttttgatcactccttttctttcaaaaaatttataaacacttaaaatatgttatattattaaagtatgtagcgtagaaaatataaccatacaacttccattcatcatcatataattatttaaaagtaatttgtgatcaaagtaacagccgtagtactcaaccgtgtcaaccaagtcagttattcaagaactgagggagtaaatattgaatgcaaaattaatatgaaaattttttcttctgctatatatcctttttcagcgtacgtatgttcactcttctgaattgattacaacttagaaactcaaggtggatatatagcgaagaaatattaacatgttaacgtttaataaaattagatgaatttgttctctttttttttgtttcaagtgatgttgatttgtaccaaaatcagatggcatgtgtcacggtcaaacttattaattaaagagatttagcatgcaatcttgacaatcaaatctttacagagaatggcatttctatatatgaagccttacatgcatgtgcataaatatttttttggagctagagtgtggtagctttacgtgccactgcatcaaagacagatagatatttccagatttttaaatatctatttatctgtgtgttttgtctaagtaaattgaaggttttttaatataagctgtatgttttagctaaaaatgaaacaactgactcaaccatttggctttacttgcatgctagcatgaaaactgtgatagaccggtataccaacgcaaaggaggagctacttggcgggaatgcaacttcagaaattaaggtatggttaagaagataagctatcttgttaattgttactatacgagaacacgcatgtgatcttgatctgacgaccaatgacagcttttagtctctttaagattgattttataaataagatgctgattggccaactagttaaagtgctgaatgcactgtgttctcatgcatgcatgcagctgggcatggtgcactgctcacgctgaagaatatagtgagaaattatttctgaacccctctggctgatgcaggcatgcagcaggggttgttactgaattacatatacattgtttactgtatatatagacgcaaacctttttataaaaaaaattcatgagaattttagatgttatcatttctaggagttttttttttctatatagtcctttttaaatcaaaataatgaattatatgaaatcttacaaaattcctatggaatgtctttttctcgtataagttttggaggaattcttgtgtttttccaatggcataatcaaacggtcatttatatatttttttcatgtgttttgtaatcatctgttttacacttagacttgcatttctgtgattcaaagcgccctcaacattttcctatcttctccttccagatgccatatataaaaaactgatgcgtgttgtgcctaatgctgatagtaccaactcctataactggagaactccagcaaactcccctcaaaggagctgaatatgcgcacaatatatgcgcacaatccgatagtacagaatcttctgaacttgaggttggcaagagctgcaagccacgcatgggccaaagggggcagattgctgcaggttcctagattaggacactgggcccaaccataatctaactaagcccctgcaaactcctcaattatcaagcgtgttctggagcaggaagaagcactagtcgatctccctcggttaatgcatcaacagtaatgcataggacgaaagtaaccgagcaattcgtaatctcaacataagcaaaaacaagcatactttaaacaagataaaacagtgtacaatacaagagcttgcagagtattgtataggcaggagaagcatttgatggtagtgcaatataatgctgtacaagttgcttgaaaataacatgctcaagtcttaatttctcagtaattaactttcttcatagtggccacactggtactcactcccgttactccactacttagcttctcacgttttcatgaaccacacacttcatcagcatctgagggcatcagggcaggccatcctcaagtttgcaaatgatggaaaatccatgcacatcctgacatcgaacgttcagccaaagaagcgtatgaagatcataaggcgattcgcgaaaaaaaaaaggggcagattataggtgcatacgtaccttttggcacgataaggacttcgctgattgcattggtccaagatacagcgcagtaatttcgctgcatcttatgacaaccacaaactcagaaaacaacacccaacacatactgaacctgtctgagtatctaacatccatatttcagaggggggcaaacttactcggtatatttatgcattatgtggcaacttggaggttaaaaacagttggagactcgaaaggaaatctaaaaactgttagaaaatggttttctaaataacagatgccaatagcgtaagcagaatggctgtaaagcaacaaagccagaacaacaaggatacatagcaaaccaagtgatattaacagttaaaagtaccgttgttgctcaattgaccagtaaactcgacagacaattgtaaacataaaaaatatataccttaagaaacaaaccgtctacgcataaaaatttcactgctgctgatggtatgatattcatgttactgaatcatgggggaatatgaagtgatattttcaggagtactagcttatgtactcctttatgaatttcatttccatgtcatcatttatttaatgtttattctttctatatgttaaggaaaaggtcaaaacaagcatccacacctacatggtctcaaagaactgtagtacatagcatgcccccacagagatccttctctttccctctattttgggttcaaaaatgccatcgctcatgaaaaatacaaaaagataccaagcaccaaaaagggataaatctgatttgccctgagtttacattggagactgtactcatcattactacagtataactgttatatcaacaaaatggttgaaaacaaagtcctgattaaagatacaattatacataagtacctcctatgtctatgcgtaagttttgtgccaacaaagtgatcagcagttatgcattatgcactccaatggccagtccataatacagatcagcaaggttatgtctagattttttttttccttagaacacagggaagttcagtgtgcaaatttttcagctaggagtttaggaccaaaggtttaaaagtctaatgatgatgaaacaaccaagctactggagcactagacaaaaacaagtgtcagctgaattgacaagttggtccaaattaatctagaataataagtactgaagactgaacaactataacactctgatgcacttgtgctacgcatatcccacatcttgagatattggaactatgtgaatcagatagcattttacctcatctcaaatgcatatgtgattgagttgtgtgtgatttttggcaacatactgcgtttctagattaatcatatgtatatagttcaaggaaactgacatgattttctttttttgctgatagatttggcagagggaggcagcaagcttgaggcagcaactgcacaacttgcaagaaagccacaagtaatcatctaatgattctgcaatggaaattgatcatacattaatataaaattcatcaagaaagtagtttatcaacaatttaaatgccacatggaattgtataagaaccaccaaaagatgcttaaatacttgaaggaaaactttaggaatataatcagaatattcactgtcagatttatcaagaaagtagtttatcaacaatttaaatgtcacatggaattgtataagaaccaccaaaagatgcttaaatacttgaaggaaaattttaggaatataattagaatattcactgtcagatttattttaatagtattcctaagtttctttaacaaataagtttggcctgtctcaaaccatgtcgacagaagagagctgtagtggcatatagattgggacttcttgaactgctgagattactcttttgcatggttgtaggcaactgatgggtgaggagctttctggcctaggtgttagagacctacaaggtttagagaataggcttgaaataagtctacgtaatatcagaatgagaaaggttatattccttgtgctcttcaatatccgtatttttgcttttgatttgctataggctaatgatgatacagtaaacacctatcaaacaggacaatcttttgaaaagtgaaatcgaggagttacatgtgaaggtttaccccttgcacttaatgtcatttcattatttcaatgcaaaagaacatgcatggaatattgtgaattttgtgtactaaatattaactttacttcagggaagcctaattcaccaggaaaacatcgaactttctagaagcctaaatgtcatgtcgcaacaaaaattggaactgtataacaaggttcgatgcaaaattctcttagaaacttgtgactacatgttaacacattatcccaagcaactaaaggaacaacttgatttcagcttcaggcctgtgaacagagaggtgccacagatgcaaatgaaagttccagcactccatacagctttcgtatcatacaaaatgctaatatgcctcctagtcttgaattgagccaatcacagcaaagagaaggggagtgcagcaaaacagctgctccagaactggggtaagtatttcttatctagaatacataaattgcattactcaaagaaggggaagctcaatcaagcacgtatgttttcatatgtagcagacttcatctgccttaagactatgccgtacaagctggacgataagtgatcaat</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0731200, RefSeq:Os02g0731200

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1