Difference between revisions of "Os08g0566600"
Longkailian (talk | contribs) (→Function) |
Longkailian (talk | contribs) (→Function) |
||
| Line 15: | Line 15: | ||
[[File:1.jpg.jpg|right|thumb|150px|'''Figure 1'''''(A) Schematic model of Fd-dependent PQ reduction in ruptured chloroplasts. ]] | [[File:1.jpg.jpg|right|thumb|150px|'''Figure 1'''''(A) Schematic model of Fd-dependent PQ reduction in ruptured chloroplasts. ]] | ||
| + | [[File:2.jpg.jpg|right|thumb|150px|'''Figure 2''''' (B) Fd-dependent PQ reduction activity in ruptured chloroplasts isolated from various lines. ]] | ||
4.CO(2) fixation and growth rate are very robust in the face of alterations in the fundamental reactions of photosynthesis under constant light conditions in rice. | 4.CO(2) fixation and growth rate are very robust in the face of alterations in the fundamental reactions of photosynthesis under constant light conditions in rice. | ||
Revision as of 08:40, 28 May 2014
Please input one-sentence summary here.
The rice Os08g0566600 was report as proton gradient regulation 5 ,which is involved in electron flow in rice Photosystem I. It is essential for photoprotection.
Contents
Annotated Information
Function
PGR5(PROTON GRADIENT REGULATION 5)gene is required for Rice photosystem I(PSI) cyclic electron transpor.The fucntions of PGR5 as follow:
1.PGR5-dependent PSI cyclic electron transporthelps to restore the balance of the oxidation of chloroplasts.
2.PGR5 plays an key role in maintaining reduction capability the iron oxide-dependent protein bodies quinone when the rice chloroplast damage.
3.PGR5 is required for ferredoxin (Fd)-dependent plastoquinone (PQ) reduction in ruptured chloroplasts of rice.
4.CO(2) fixation and growth rate are very robust in the face of alterations in the fundamental reactions of photosynthesis under constant light conditions in rice.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1.Department of Botany, Graduate School of Science, Kyoto University, Sakyo-ku, Kyoto, 606-8502 Japan
2.CREST, Japan Science and Technology Agency, Chiyoda-ku, Tokyo, 102-0076 Japan
3.Department of Applied Plant Science, Graduate School of Agricultural Science, Tohoku University, Sendai, 981-8555 Japan
4.National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan
References
1. PGR5-Dependent Cyclic Electron Transport Around PSI Contributes to the Redox Homeostasis in Chloroplasts Rather Than CO2 Fixation and Biomass Production in Rice Plant and Cell Physiology, 2012, 53(12): 2117-2126
Structured Information
| Gene Name |
Os08g0566600 |
|---|---|
| Description |
Similar to PGR5 |
| Version |
NM_001069077.1 GI:115477892 GeneID:4346358 |
| Length |
1075 bp |
| Definition |
Oryza sativa Japonica Group Os08g0566600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 8:28465852..28466926 |
| Sequence Coding Region |
28465967..28466239,28466430..28466534 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008401:28465852..28466926 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008401:28465852..28466926 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctga</cdnaseq> |
| Protein Sequence |
<aaseq>MAAAAASSVSLPGARALPTWSSSVSGDSHSLALSSWAARPRSAR PLRAPARMGNVNEGKGIFAPVVVVVRNIVGRKRFNQLRGKAIALHSQVITEFCKTIGA DAKQRQGLIRLAKKNGEKLGFLA</aaseq> |
| Gene Sequence |
<dnaseqindica>116..388#579..683#actccactccacccaccggattgctaacttgcttcctccgtccgcggccaccactttctcctctcctcctcagagcaagatcattcaagtataatcctgcctcctactagctataatggcagcagctgcagcatcatccgtgtccctccccggggcgagggctctcccgacgtggtccagctccgtgtccggcgactcgcactcgttggcgctgagctcgtgggcggcgcggcctcggtcggcgcggccactgcgggcgccggcgaggatgggcaacgtgaacgagggcaaggggatcttcgcaccggtggtggtggtggtgcgcaacatcgttggccgcaagcgcttcaaccagctcaggggaaaggccatcgcgctgcactcgcaggtacgcacgtctactctactccgatcctcatcaattatagtacactagttttaattaattagctatcatcatctgccatgccatatatataagcaaattttgcaatcaaacatatcaatatgcttgctatctatcttgtgagtgagtgacttgtggccatcgatgatacggacggtactgcttgttgcaggtgatcaccgagttctgcaagaccatcggcgccgacgccaagcagaggcagggcttgatccgccttgccaagaagaacggcgagaagctcggtttccttgcctgatcgacatgcccttcctaattcctactagctcatttgattggtgtggatttcctctctgaatgaatgaatttcctgtagctagctagccagccgcgccttcctccctgcgtataaatgtgtcttgtgcgtacgtatacctcctcttctgaccttcaattccatccatccatgccatggcggcatgaacgaatgaattagtagtaagtaatacgcgcatgcatgaacgaatgaataatatactatataatgcgtgtatacagacactagcgctggctagcatgtatgatgatcatgatgtatatgtatgagactgagactgtatgtagccagttaagcgacatcattgccgtcaagctccaatcggatggatctggatctcctagtcaatcttt</dnaseqindica> |
| External Link(s) |