Difference between revisions of "Os03g0315400"

From RiceWiki
Jump to: navigation, search
Line 14: Line 14:
 
[[File:Responses of seed germination and seedling growth to treatment with NaCl and abscisic acid (ABA).jpg]]  
 
[[File:Responses of seed germination and seedling growth to treatment with NaCl and abscisic acid (ABA).jpg]]  
  
3、OsMYB2-overexpression plants accumulated greater amount of proline and soluble sugars(figure 3).
+
3、''OsMYB2''-overexpression plants accumulated greater amount of proline and soluble sugars(figure 3).
  
 
[[File:Effect of salt stress on contents of proline and soluble sugars and gene expression in wild-type and transgenic rice plants.jpg]]
 
[[File:Effect of salt stress on contents of proline and soluble sugars and gene expression in wild-type and transgenic rice plants.jpg]]
 +
 +
4、''OsMYB2''-overexpression plants accumulated less H2O2 and MDA under salt stress(figure 4).
 +
 +
[[File:Effect of salt stress on contents of oxidants (A and B) and antioxidant enzymes (C–D) in wild-type and transgenic rice plants.jpg]]
 +
 +
  
 
===Expression===
 
===Expression===

Revision as of 04:50, 30 May 2014

Its gene name OsMYB2, is a R2R3-type MYB gene, expression a MYB-type transcription factor plays a important role in the tolerance to abiotic stress of plants.

Annotated Information

Function

1、Overexpression of OsMYB2 enhanced tolerance to salt cold, and dehydration stress(figure 1).

The tolerance to abiotic of overexpression and RNAi of OsMYB2.jpg

WT:wildtype; OE2 and OE3: OsMYB2 overexpression strain; Ri1 and Ri3: OsMYB2 RNAi strain;

2、Overexpression of OsMYB2 altered sensitivity of seed germination and growth to salt stress and ABA(figure 2).

Responses of seed germination and seedling growth to treatment with NaCl and abscisic acid (ABA).jpg

3、OsMYB2-overexpression plants accumulated greater amount of proline and soluble sugars(figure 3).

Effect of salt stress on contents of proline and soluble sugars and gene expression in wild-type and transgenic rice plants.jpg

4、OsMYB2-overexpression plants accumulated less H2O2 and MDA under salt stress(figure 4).

Effect of salt stress on contents of oxidants (A and B) and antioxidant enzymes (C–D) in wild-type and transgenic rice plants.jpg


Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0315400

Description

Similar to Typical P-type R2R3 Myb protein (Fragment)

Version

NM_001056472.1 GI:115452672 GeneID:4332651

Length

2127 bp

Definition

Oryza sativa Japonica Group Os03g0315400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:11376759..11378885

Sequence Coding Region

11377201..11378033,11378520..11378676

Expression

GEO Profiles:Os03g0315400

Genome Context

<gbrowseImage1> name=NC_008396:11376759..11378885 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:11376759..11378885 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtga</cdnaseq>

Protein Sequence

<aaseq>MDMAHERDASSEEEVMGGDLRRGPWTVEEDLLLVNYIAAHGEGR WNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNITPQEQLLILELHSRWGNRWSKIAQ HLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDVMRYLWMPRLVERIQAAAAGQQ QQQEGGTDTPPLSWQHGGSDGLYESPELPAPDASCWPAEYCAAAGGAQSGGTPAPELS STTAGSSSLSTDSGAGAQPSWPTQADGAEWFTTACDASSATGGVAMRDTELELAQPPC QGGQTWTTSESSLPGLTFPDLAVADFEIGGFDVDSFWTSMEDDQLWCPTQAAV</aaseq>

Gene Sequence

<dnaseqindica>853..1685#210..366#agtttcatcgcagcacacatccatccatccatccatctatccagagagcacagcaacggcgcatatatagtacccctctaccaaagcacaacaaccagaatctcctgagctcgatctagctactagcttgatctatccgatcaatcgactggcccgcgaggatcgatcgagactcgaaagggagggattttgatccggatcggtcgacgatggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcaggtaggatcgcgatctcgatcgatcgagctcccaattccaccataaattacatgcacgcacacatcgatcaattccatgagctgagtgtccgtacatgcttagcctgatgagcaattataggacgcaaagtaccagtcgctcttgcatctacatgctgatttctggaaacacagatagctacgagtctaccctgagttctctagcagccaaccagctaagctagaagctatagtgagtgagagggaaaggggagagaatttttagtggttagcagcgtagctagcattgttcatagggatatttttagttgctcatccctcccccgttacatcatccatcctgccgtcgtcgtatgcgtataactgcattagtatataattgattagttgctgcatactatgttttagcaatggtgtactacatgtgaatattttgatgtgacgtgaagagaaaaattaatcttggtttttggttgttgtcatgcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtgaaaagtcagcacggccgccatgggaatccgccgcggcgagcgagcgcgcgcgcgcgcgacacccgcgggtgcacaaccgccggggacgcgtagcggagcggagaagcggattagaagaaggagagaagctatctgggggattagaacaagattaatcgcctcacgatgccatttttggactcctagctcccagactattctaactccagttcttttccgtttctttctccttttttacttcctagggtaaaaaaaaagaagttaaagtgtagccgttatactagtgttgatgctgctgttactaaagtttgtccgttaaattttactcattctttttgagtaaatacagtactgccactactgtatgtacgagctgaactctgtaggattgacaggattactgtacacttctagaaaccggtaataaaagcaaagctccgacg</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0315400, RefSeq:Os03g0315400