Difference between revisions of "Os02g0516400"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(References)
Line 20: Line 20:
  
 
==References==
 
==References==
Please input cited references here.
+
Renhong Wu,Shibai Li,Shan He,Friedrich Waßmann,Caihong Yu,Genji Qin,Lukas Schreiber,Li-Jia Qu,Hongya Gu. CFL1, a WW Domain Protein, Regulates Cuticle Development by Modulating the Function of HDG1, a Class IV Homeodomain Transcription Factor, in Rice and Arabidopsis. The Plant Cell, 2011, 23(9): 3392-3411
  
 
==Structured Information==
 
==Structured Information==

Revision as of 07:40, 30 May 2014

Please input one-sentence summary here.

Annotated Information

Function

CFL1 encodes a WW domain protein, and there are two homologs of rice CFL1in Arabidopsis:At CFL1 and At CFL2. Arabidopsisplants overexpressing AtCFL1displayed organ fusion phenotypes with decreased levels of epicuticular wax and defective cuticles. Loss-of- CFL1-function resulted in an enhancement of cuticle properties in Arabidopsis. Biochemical evidence showed that At CFL1 interacts with HDG1, a class IV homeodomain-leucine zipper transcription factor. Suppression of HDG1 function resulted in similar defective cuticle phenotypes in wild-type Arabidopsis but much alleviated phenotypes in Atcfl1-1 mutants. The expression of two cuticle development-associated genes,BDGand FDH, was downregulated in At CFL1 overexpress or and HDG1 suppression plants. HDG1 binds to the cis-element L1 box, which exists in the regulatory regions of BDGand FDH. rice and Arabidopsis CFL1 negatively regulate cuticle development by affecting the function of HDG1, which regulates the downstream genes BDGand FDH.

Expression

At CFL1 was predominantly expressed in specialized epidermal cells and in regions where dehiscence and abscission occur.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

State Key Laboratory for Protein and Plant Gene Research, College of Life Sciences, Peking University Institut fur Zellulare and Molekulare Botanik, Universitat Bonn The National Plant Gene Research Center (Beijing)

References

Renhong Wu,Shibai Li,Shan He,Friedrich Waßmann,Caihong Yu,Genji Qin,Lukas Schreiber,Li-Jia Qu,Hongya Gu. CFL1, a WW Domain Protein, Regulates Cuticle Development by Modulating the Function of HDG1, a Class IV Homeodomain Transcription Factor, in Rice and Arabidopsis. The Plant Cell, 2011, 23(9): 3392-3411

Structured Information

Gene Name

Os02g0516400

Description

WW/Rsp5/WWP domain containing protein

Version

NM_001053492.2 GI:297599303 GeneID:4329477

Length

2393 bp

Definition

Oryza sativa Japonica Group Os02g0516400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:19418357..19420749

Sequence Coding Region

19418357..19418980,19420549..19420749

Expression

GEO Profiles:Os02g0516400

Genome Context

<gbrowseImage1> name=NC_008395:19418357..19420749 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:19418357..19420749 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgactgccccgaacatcgagatgatcgcctcgtcgctgcgcaactgctccctcaacggcgggggaggaggaggaggagggcggcgcagggggaggcgcgcggcggcggcggaggggagcgacgacagcgagggggtcaccgtcgagctcaactccgaggtcgccctgccctaccactgggagcagtgcctcgacatccggacggggcaagtttactacatcaactgggaggacggcacccggacgaccatcgatccgcgctcgtcgtcggcgtactcgccgtcgccggcgtcgcggtccgcgtcgtcctcctcccgccgctgctcgcgcgcgcggggccgcggcggcggaggcggcgccgccgccgcggcgtcgaccaccacgtcgtcggggtacacctccgtgtcgtccgtgggcgcggtcaccgcggcggcggcggcgtggcgctcgcacgacagcagcgggcacggctacggctacggctacggctacggcagctatggctacggctacggctacgacggccgcgacggcgacgacgaggagagcagcagcagcagtagcagcagcagcagcagcagcagcagcgccagcagcagccggggctccgccgtgtcgtccacgctctcgtcgttctcccccaccgacgagtcggcctccggcgccggcagcggctacgccgtcggcgacaacggcgcccacgtcctcgtcgccgccggctgccgggcttgcttcatgtacttcatggtgccgaagaccgccgacgtgtgccccaagtgcggcagctccggcctcctccacctcagccgcaacggctacgtctga</cdnaseq>

Protein Sequence

<aaseq>MTAPNIEMIASSLRNCSLNGGGGGGGGRRRGRRAAAAEGSDDSE GVTVELNSEVALPYHWEQCLDIRTGQVYYINWEDGTRTTIDPRSSSAYSPSPASRSAS SSSRRCSRARGRGGGGGAAAAASTTTSSGYTSVSSVGAVTAAAAAWRSHDSSGHGYGY GYGYGSYGYGYGYDGRDGDDEESSSSSSSSSSSSSSASSSRGSAVSSTLSSFSPTDES ASGAGSGYAVGDNGAHVLVAAGCRACFMYFMVPKTADVCPKCGSSGLLHLSRNGYV</aaseq>

Gene Sequence

<dnaseqindica>1770..2393#1..201#atgactgccccgaacatcgagatgatcgcctcgtcgctgcgcaactgctccctcaacggcgggggaggaggaggaggagggcggcgcagggggaggcgcgcggcggcggcggaggggagcgacgacagcgagggggtcaccgtcgagctcaactccgaggtcgccctgccctaccactgggagcagtgcctcgacatccgggtacgtctactactactcgcccatctcttcttccacacatgcatccatacatgcatacgccgcgtttccttttcttccccgatcgattcttgcggcggcggcggcggtgggcggcggcgcgccgccctttgtccaatcatttggagacataaatggatagcagtttccgaggtaggtgggtgtggtttggtttgggctcgattgggatcaatcatttgatcattaatggcgaaagcgggcgctcgaactggagagagagacgagacgagacgacccgtccgcgctgattttttttttcttcttcctcctcttctctttctgctcctcgtctcccttctctcttcttgttcttgttcttggatccttgcttcatctgcgattcctctcttcgtctatgcaaatattttttttatttatctctgttttttttcttcggttcttatcttcgtttggttggggattcgatcatcttcagagagattcaggccgttctttttaacacagggatgacaaaagttcagaaaagaaacctcggaaaagatggtactatttttttctttttttttgttgatgatatcaaggctcttcaaatctccacaccttctctggtctctgatctaagcgcgcattcagatctgtgttgcattctaaatttctgacacatccctgtagatccattcctttttgctctgtctctatctgaaactctagatttcgctatagatttcttctggaccacaatgctctgtttttttggtcctgggttctaatctaatcgcagagctttgttaaacaccagatgattctcacctctgggaaatcttcagttccattgtgacaaagtgtctccctttctttttcatccctgctagtactttgaacagacgaatgaatgcctaccccaatgaagattcatgcgtattaatcaccaaaatggagtgttcatctccaccttgtctccagcaacagagtagacaaaaatgctcttcttatggttatttcagtagccttttctgaagatactactgcaatacatttatgtgctttttaagtagaacagctttcctgcagattagagtttttttttttttacaaaggatgaaatgagaatttggtggtggtgttcttcattgccaaccttgccctgtgatttgcaaacaaacaagaggacaaagagagcagcattcattacaccatttgatccagattttttttctttcccctgttctgctgtactttgttatgggcatcagttattaataggttctcaaccttgtttcacggaagcaactgaatgccaccgcattaattgttcttgcagactgtcaccaaaatgtacttgtagattttccccacccaaacttctccatgcatcatgcacatttactcaccacattcttgaaacagcatttcgccatttgcaagattaacttaatctgtaccactagctgtctagttcaagcgcatttcctttattgttattatttttagatgaattttgatgtgtagttcatgacttcatgtgaatttgtgtgaaatgtgctttgtgattggctttgctgatgcagacggggcaagtttactacatcaactgggaggacggcacccggacgaccatcgatccgcgctcgtcgtcggcgtactcgccgtcgccggcgtcgcggtccgcgtcgtcctcctcccgccgctgctcgcgcgcgcggggccgcggcggcggaggcggcgccgccgccgcggcgtcgaccaccacgtcgtcggggtacacctccgtgtcgtccgtgggcgcggtcaccgcggcggcggcggcgtggcgctcgcacgacagcagcgggcacggctacggctacggctacggctacggcagctatggctacggctacggctacgacggccgcgacggcgacgacgaggagagcagcagcagcagtagcagcagcagcagcagcagcagcagcgccagcagcagccggggctccgccgtgtcgtccacgctctcgtcgttctcccccaccgacgagtcggcctccggcgccggcagcggctacgccgtcggcgacaacggcgcccacgtcctcgtcgccgccggctgccgggcttgcttcatgtacttcatggtgccgaagaccgccgacgtgtgccccaagtgcggcagctccggcctcctccacctcagccgcaacggctacgtctga</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0516400, RefSeq:Os02g0516400