Difference between revisions of "Os02g0677300"

From RiceWiki
Jump to: navigation, search
(Structured Information)
(Structured Information)
Line 58: Line 58:
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Japonica Chromosome 2]]
 
[[Category:Chromosome 2]]
 
[[Category:Chromosome 2]]
PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.
+
1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.

Revision as of 01:47, 31 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation(Thomashow, 2010).The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0677300

Description

Similar to CRT/DRE binding factor 1

Version

NM_001054262.1 GI:115447894 GeneID:4330306

Length

1272 bp

Definition

Oryza sativa Japonica Group Os02g0677300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:28539796..28541067

Sequence Coding Region

28539841..28540515

Expression

GEO Profiles:Os02g0677300

Genome Context

<gbrowseImage1> name=NC_008395:28539796..28541067 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:28539796..28541067 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>

Protein Sequence

<aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>

Gene Sequence

<dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0677300, RefSeq:Os02g0677300

1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.