Difference between revisions of "Os02g0677300"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation<ref name="ref1"/>.The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants.
Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation<ref name="ref1"/>.The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants<ref name=”ref2”/>.
 
  
 
===Expression===
 
===Expression===

Revision as of 04:24, 31 May 2014

Please input one-sentence summary here.

Annotated Information

Function

Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.In the cold response pathway ,it has proven to play important roles in cold acclimation[1].The main function is to bind to the CRT/DRE regulatory element and activate the expression of downstream target genes ,which is very important for inhancing the cold tolerance of rice.The accumulation of gene's transcription factors will inhibit the growth of plants.

Expression

Please input expression information here. CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation[2]. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes [3]. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) [4]. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes [5]. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato[6]; [7]; [8]; [9]. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice [10];[11].Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D(Ito et al, 2006). The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will. CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain.we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position, which play important roles in DNA-binding specificity[1].

Labs working on this gene

Please input related labs here.

References

1. The rice research institute of Sichuan Agricultural University Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim Biophys Acta, 1799: 454–462. Carvallo M A, Pino M T, Jekni Z, Zou C, Doherty C J, Shiu S H, Chen T H H, Thomashow M F. 2011. A comparison of the low temperature transcriptomes and CBF regulons of three plant species that differ in freezing tolerance: Solanum commersonii, Solanum tuberosum, and Arabidopsis thaliana.J Exp Bot,62(11): 3807–3819. Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054. Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763. Fowler S, Thomashow M F. 2002. Arabidopsistranscriptome profiling indicates that multiple regulatory pathways are activated during cold acclimation in addition to the CBF cold response pathway. Plant Cell Online, 14: 1675–1690. Hannah M A, Wiese D, Freund S, Fiehn O, Heyer a G, Hincha D K. 2006. Natural genetic variation of freezing tolerance in Arabidopsis. Plant Physiol, 142: 98–112. Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

Structured Information

Gene Name

Os02g0677300

Description

Similar to CRT/DRE binding factor 1

Version

NM_001054262.1 GI:115447894 GeneID:4330306

Length

1272 bp

Definition

Oryza sativa Japonica Group Os02g0677300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:28539796..28541067

Sequence Coding Region

28539841..28540515

Expression

GEO Profiles:Os02g0677300

Genome Context

<gbrowseImage1> name=NC_008395:28539796..28541067 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:28539796..28541067 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>

Protein Sequence

<aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>

Gene Sequence

<dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0677300, RefSeq:Os02g0677300

1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.
  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Dref1.E2.80.9D
  3. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Dref2.E2.80.9D
  4. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Dref3.E2.80.9D
  5. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Dref4.E2.80.9D
  6. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Dref5.E2.80.9D
  7. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Dref6.E2.80.9D
  8. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Dref7.E2.80.9D
  9. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Dref8.E2.80.9D
  10. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Dref9.E2.80.9D
  11. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Dref10.E2.80.9D