Difference between revisions of "Os09g0380200"
(→Function) |
(→References) |
||
| Line 17: | Line 17: | ||
==References== | ==References== | ||
| − | + | oung Leaf Chlorosis 1, a chloroplast-localized gene required for chlorophyll and lutein accumulation during early leaf development in rice | |
| + | Kunneng Zhou, Yulong Ren, Jia Lv, Yihua Wang, Feng Liu, Feng Zhou, Shaolu Zhao, Saihua Chen, Cheng Peng, Xin Zhang, Xiuping Guo, Zhijun Cheng, Jiulin Wang, Fuqing Wu, Ling Jiang, Jianmin Wan | ||
==Structured Information== | ==Structured Information== | ||
Revision as of 07:04, 31 May 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Chlorophyll (Chl) and lutein are the two most abundant and essential components in photosynthetic apparatus, and play critical roles in plant development. In this study, we characterized a rice mutant named young leaf chlorosis 1 (ylc1) from a 60Co-irradiated population. Young leaves of the ylc1 mutant showed decreased levels of Chl and lutein compared to those of wild type, and transmission electron microscopy analysis revealed that the thylakoid lamellar structures were obviously loosely arranged. Whereas, the mutant turns green gradually and approaches normal green at the maximum tillering stage. The Young Leaf Chlorosis 1 (YLC1) gene was isolated via map-based cloning and identified to encode a protein of unknown function belonging to the DUF3353 superfamily. Complementation and RNA-interference tests confirmed the role of the YLC1 gene, which expressed in all tested rice tissues, especially in the leaves. Real-time PCR analyses showed that the expression levels of the genes associated with Chl biosynthesis and photosynthesis were affected in ylc1 mutant at different temperatures. In rice protoplasts, the YLC1 protein displayed a typical chloroplast location pattern. The N-terminal 50 amino acid residues were confirmed to be necessary and sufficient for chloroplast targeting. These data suggested that the YLC1 protein may be involved in Chl and lutein accumulation and chloroplast development at early leaf development in rice.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
oung Leaf Chlorosis 1, a chloroplast-localized gene required for chlorophyll and lutein accumulation during early leaf development in rice Kunneng Zhou, Yulong Ren, Jia Lv, Yihua Wang, Feng Liu, Feng Zhou, Shaolu Zhao, Saihua Chen, Cheng Peng, Xin Zhang, Xiuping Guo, Zhijun Cheng, Jiulin Wang, Fuqing Wu, Ling Jiang, Jianmin Wan
Structured Information
| Gene Name |
Os09g0380200 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001069588.1 GI:115478918 GeneID:4346927 |
| Length |
1061 bp |
| Definition |
Oryza sativa Japonica Group Os09g0380200, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 9:13431725..13432785 |
| Sequence Coding Region |
13431849..13432058,13432357..13432433,13432523..13432673 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008402:13431725..13432785 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008402:13431725..13432785 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgaagagctaccagcagcggaaaaagactaagattaatctgaaaactaagctaaaaaagcgagttgaggaatccccgtcatgggtaaaggcactgcttggatattttgaggtgccacaaatggatatcatttcaagaagattgttctttttcgctttcattgctggttggagcatagcgacttctgctgagaatggacctgcattccagcttgcaatatctctcttctcgtgcatatatttccttaatgataagatgaagaacctcatgagggcatcaacaactgggtttggagtgcttgttggtggctggataattggctctctattggtcccacttatcccaacattcatcatcccaccctcttggtcccttgagctacttacatcattagttgcatatgtcttcctgttcctgggttgcactttcctcaaatga</cdnaseq> |
| Protein Sequence |
<aaseq>MKSYQQRKKTKINLKTKLKKRVEESPSWVKALLGYFEVPQMDII SRRLFFFAFIAGWSIATSAENGPAFQLAISLFSCIYFLNDKMKNLMRASTTGFGVLVG GWIIGSLLVPLIPTFIIPPSWSLELLTSLVAYVFLFLGCTFLK</aaseq> |
| Gene Sequence |
<dnaseqindica>125..334#633..709#799..949#tcttggtgttgatcgtgatgcagctgaagaagagatcaggagtgctagaaatttccttattcaacagtatgctgggcatgaaccaagtgaagaagctattgaaggtgcatacgagaagataataatgaagagctaccagcagcggaaaaagactaagattaatctgaaaactaagctaaaaaagcgagttgaggaatccccgtcatgggtaaaggcactgcttggatattttgaggtgccacaaatggatatcatttcaagaagattgttctttttcgctttcattgctggttggagcatagcgacttctgctgagaatggacctgcattccaggtatctgtgctttggtttttgctggcctttcaagttgtttttttcttgtttgatgacatatttcaattcatagcagtccaagaaggcaatctagtttgcacgtaaaatgcatatgcttgttcattcatctgaaaatttaaattatccaatgtaaccaacatctcttgttgagggtataaagacaatgcaaggcctaataactcctaaattttaaatatttatgcaatactagcttaatacacttcccatcttgagcacaacttctctagttgactagtttttttttttccttttgcagcttgcaatatctctcttctcgtgcatatatttccttaatgataagatgaagaacctcatgagggcatcaacaactgggttagtgggaattttttcacttgatatccatcggaccgtagcttgcctactttgatatcaatatcatgcttactcttttgttcttccaggtttggagtgcttgttggtggctggataattggctctctattggtcccacttatcccaacattcatcatcccaccctcttggtcccttgagctacttacatcattagttgcatatgtcttcctgttcctgggttgcactttcctcaaatgaaaaccttgtaaatcttgtaaccgtaaattgtagaattgcttgcagaaattttgcaactactgacatctccactatgggtctcggaaaagttttgtagaatgacatcactttg</dnaseqindica> |
| External Link(s) |
