Os01g0897700

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

This gene is cloned from Oryza sativa. It belongs to a large family of multi-domain proteins that exist in yeast, plants, and animals, and they participate in linear actin polymer assembly. Formins are identified by the highly conserved formin homology 2 (FH2) domain. Most plant formins contain a more variable formin homology 1 (FH1) domain[1].Based on phylogenies derived from the conserved FH2 sequences and the organization of their N-terminal domains, plant formins can be mainly divided into two distinct subfamilies: there are 11 class I formins (OsFH1, OsFH2, OsFH4, OsFH8 to OsFH11, and OsFH13 to OsFH16) and five class II formins (OsFH3, OsFH5 to OsFH7, and OsFH12) in O.sativa[3]. Vesicle trafficking, cytoskeleton reorganization, and cell wall loosening and synthesis are major driving forces for root-hair elongation. Rice formin 1 (OsFH1) is important for root-hair development. Besides,the Osfh1 knock-out mutants showed a defect in root-hair elongation. Aerobic growth rescues the genetic defect of OsFH1. Therefore, it is reasonable to speculate that cellular differences that are crucial for root-hair growth processes might exist between roots grown submerged in liquid versus roots grown in air. OsFH1is most required for elongation processes when root hairs are grown under the submerged condition[1].

Expression

Please input expression information here.

Plant root hair development is regulated by a regulatory network and external conditions, such as hormones, nutrients and physical treatments. Since rice is grown in water-logged paddy fields, rice root hairs are exposed to physical and chemical conditions that are different from those of upland plants such as wheat and corn. Compared with Arabidopsis, only a few genes have been reported to regulate root hair development in rice. The phenotypic effect of OsFH1on root hair development was verified by using three independent mutants, one point mutation and two T-DNA insertions[2]. OsFH1-mediated cellular processes are required for the elongation of submerged root hairs. It is likely that submergence induces physiological or cellular changes that interfere with root hair elongation and that OsFH1overcomes these changes via some physiological factor involved in root hair elongation. Considering that rice grows in water-logged soil, OsFH1has an important role to play in rice plant survival under this condition. The physiological factor that mediates the effect of OsFH1 on root hair elongation remains to be identified.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name	Os01g0897700
Description	Similar to FH protein NFH1
Version	NM_001051625.1 GI:115441620 GeneID:4325107
Length	1054 bp
Definition	Oryza sativa Japonica Group Os01g0897700, complete gene.
Source	Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome	Chromosome 1
Location	Chromosome 1:40769673..40770726
Sequence Coding Region	40769990..40770463
Expression	GEO Profiles:Os01g0897700
Genome Context	<gbrowseImage1> name=NC_008394:40769673..40770726 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>
Gene Structure	<gbrowseImage2> name=NC_008394:40769673..40770726 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>
Coding Sequence	<cdnaseq>atggactccgacgtgctaagcagctatgtctcgaaacttgctggaggaatagagaagatcactgaggtgttgcggttgaatgaagaagtcaagtccagggaagatgcatggaggttccatgattcaatgcagaagttcttgaagagggctgatgacgacatcatcagggttcaggctcaggagagcgttgcgctatcacttgtgaaggagatcaccgagtacttccatggtgactctgcgaaagaggaagctcaccctttcaggatcttcatggtggtcagggatttcctctcagttcttgatcaagtctgcaaggaagttggcaggatcaatgaccgcacgatcgctagctcggtgcgccatttcccagtacccgtcaacccaatgatgccacagttgttccccaggattcatgctttgagagctggaatctcagatgatgaaagttcagccacttcagcatcatcaccttga</cdnaseq>
Protein Sequence	<aaseq>MDSDVLSSYVSKLAGGIEKITEVLRLNEEVKSREDAWRFHDSMQ KFLKRADDDIIRVQAQESVALSLVKEITEYFHGDSAKEEAHPFRIFMVVRDFLSVLDQ VCKEVGRINDRTIASSVRHFPVPVNPMMPQLFPRIHALRAGISDDESSATSASSP</aaseq>
Gene Sequence	<dnaseqindica>264..737#atcgcggcgatgcacacgcgttcaagcttgatactctactcaaattggttgatgtcaaaggcactgatggcaagactacacttttgcattttgtcgtgcaggagattatccgaacggagggctcccacctctctgctagcaaccaatcaactccacgaactcaggcaaaccctttacgggacgagctcgagtgcaaaaagcttggcctccaggtagtggctggcctcggaaacgagctcagcaatgtcaagaaggcagctgccatggactccgacgtgctaagcagctatgtctcgaaacttgctggaggaatagagaagatcactgaggtgttgcggttgaatgaagaagtcaagtccagggaagatgcatggaggttccatgattcaatgcagaagttcttgaagagggctgatgacgacatcatcagggttcaggctcaggagagcgttgcgctatcacttgtgaaggagatcaccgagtacttccatggtgactctgcgaaagaggaagctcaccctttcaggatcttcatggtggtcagggatttcctctcagttcttgatcaagtctgcaaggaagttggcaggatcaatgaccgcacgatcgctagctcggtgcgccatttcccagtacccgtcaacccaatgatgccacagttgttccccaggattcatgctttgagagctggaatctcagatgatgaaagttcagccacttcagcatcatcaccttgatcaccagtagtctgccaatagaaatttttcgcagagtactgtgggaaacctccatagggcagagggagaccaacggcgacggggtgtcaaatttttttttgaaccttttgtacctgtagattatagaatgtaagaagtttttttgcaaatatttatttctatatataagaggagataaaatctagatcagaggaggaaataagcagttcatgtgtttgtcatcttcagtctgtacatgacacgaggtagtgaaacagcctgtacaatgtactaacaatttcaagtatggccagtctgcagaattcaaaggtaagctg</dnaseqindica>
External Link(s)	NCBI Gene:Os01g0897700, RefSeq:Os01g0897700