Difference between revisions of "Os08g0424500"

From RiceWiki
Jump to: navigation, search
Line 50: Line 50:
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
In the nonfragrant rice cv Nanjing11, Badh2 transcripts were detected in all tissues tested except for the roots. The Badh2 transcript was more abundant in the initial fully expanded leaf than in other tissues (Figure 2). Interestingly, a similar transcription pattern with a lower transcription level was observed for the badh2-E7 allele in the fragrant rice cv Wuxiangjing (Figure 2). This indicates that sequence alterations specific to the badh2-E7 allele significantly reduce its transcription levels but cause only a slight change in its transcription pattern.
 +
 
 +
[[File:Expression11.png|right|thumb|250px|'''Figure3.''' '' Examination of the Badh2/badh2 Transcription Levels in
 +
Various Plant Tissues Using Real-Time RT-PCR
 +
Initial fully expanded leaf (A), last fully expanded leaf (B), stem (C), youngpanicle at the booting stage (D), panicle at the heading stage (E), panicle
 +
at 15 d after the heading stage (F), and roots (G) are shown. The relativetranscription level for each plant tissue was represented as a 2 DCT
 +
value. Error bars represent the SD of transcription levels determined from the three independent real-time PCRs..From(from reference <ref name="ref1"/>).'']]
 +
 
  
 
===Evolution===
 
===Evolution===

Revision as of 08:51, 1 June 2014

Os08g0424500 is reported as Badh2, encoding betaine aldehyde dehydrogenase (BADH2) .

Annotated Information

Function

Figure1. 2AP Levels and Their Significant Differences among Nontransgenic Lines and Three Kinds of Transgenic Lines Carrying Different Badh2 CDS Driven by the CaMV35S Promoter.From(from reference [1]).

BADH2, encoding betaine aldehyde dehydrogenase (BADH2) inhibits the synthesis of 2-acetyl-1-pyrroline (2AP), a potent flavor component in rice fragrance.In rice the nitrogen in the pyrroline ring of proline becomes the nitrogen in the pyrroline ring of 2AP while the carboxyl group of proline is removed and replaced with an acetyl group from another source found that in L. hilgardii the acetyl group of 2AP can be derived from fructose when either ethanol or acetaldehyde are supplied in excess. They further suggested D1pyrroline, a product of proline catabolism via putrescine oxidation, is the immediate precursor of the pyrroline ring of 2AP and the acetyl group was most likely formed from reaction with acetyl-CoA or acetaldehyde in either a chemical or enzymatic reaction. Additionally, detailed precursor studies have revealed that the formation of 2AP in Bacillus cerus proceeds via acetylation of D1pyrroline.

The intact BADH2 protein encoded by the complete Badh2 gene sequence was shown to influence this critical switch, possibly due to its strong AB-ald dehydrogenase activity. From its activity in vitro, we conclude that, in nonfragrant rice, the BADH2 enzyme converts AB-ald into GABA, inhibiting 2AP biosynthesis. In fragrant rice lacking intact BADH2, failure to convert AB-ald into GABA due to the absence of BADH2 enzymatic activity results in AB-ald accumulation, which activates 2AP biosynthesis. Interestingly, the low level of BADH2 detected in some transgenic lines overexpressing Badh2 might not completely inhibit the consumption of AB-ald, resulting in a small quantity of 2AP.


Protein Structure

BADH2 could be divided into three domains: a NAD binding domain (residues 9 to 124 and 152 to 262), an oligomerization domain (residues 129 to 151 and 480 to 486), and a substrate binding domain (residues 263 to 464).

Figure2. The Three-Dimensional Structure of BADH2 and the Annotated Active Sites.From(from reference [1]).


















Expression

In the nonfragrant rice cv Nanjing11, Badh2 transcripts were detected in all tissues tested except for the roots. The Badh2 transcript was more abundant in the initial fully expanded leaf than in other tissues (Figure 2). Interestingly, a similar transcription pattern with a lower transcription level was observed for the badh2-E7 allele in the fragrant rice cv Wuxiangjing (Figure 2). This indicates that sequence alterations specific to the badh2-E7 allele significantly reduce its transcription levels but cause only a slight change in its transcription pattern.

Figure3. Examination of the Badh2/badh2 Transcription Levels in Various Plant Tissues Using Real-Time RT-PCR Initial fully expanded leaf (A), last fully expanded leaf (B), stem (C), youngpanicle at the booting stage (D), panicle at the heading stage (E), panicle at 15 d after the heading stage (F), and roots (G) are shown. The relativetranscription level for each plant tissue was represented as a 2 DCT value. Error bars represent the SD of transcription levels determined from the three independent real-time PCRs..From(from reference [1]).


Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. 1.0 1.1 1.2 Saihua Chen,Yi Yang, Weiwei Shi, Qing Ji, Fei He,Ziding Zhang, Zhukuan Cheng, Xiangnong Liu, Mingliang Xu, Badh2, Encoding Betaine Aldehyde Dehydrogenase, Inhibits the Biosynthesis of 2-Acetyl-1-Pyrroline, a Major Component in Rice Fragrance, The Plant Cell, July 2008, Vol. 20: 1850–1861.

Structured Information

Gene Name

Os08g0424500

Description

Similar to Betaine aldehyde dehydrogenase

Version

NM_001068368.1 GI:115476473 GeneID:4345606

Length

6153 bp

Definition

Oryza sativa Japonica Group Os08g0424500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:20467829..20473981

Sequence Coding Region

20467975..20468083,20468183..20468325,20469378..20469458,20469554..20469702,20470400..20470492
,20470624..20470747,20470832..20470897,20471088..20471154,20471847..20471923
,20472279..20472392,20472793..20472870,20472952..20473103,20473207..20473267
,20473539..20473645,20473744..20473834

Expression

GEO Profiles:Os08g0424500

Genome Context

<gbrowseImage1> name=NC_008401:20467829..20473981 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:20467829..20473981 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccacggcgatcccgcagcggcagctcttcgtcgccggcgagtggcgcgcccccgcgctcggccgccgcctccccgtcgtcaaccccgccaccgagtcccccatcggcgagatcccggcgggcacggcggaggacgtggacgcggcggtggcggcggcgcgggaggcgctgaagaggaaccggggccgcgactgggcgcgcgcgccgggcgccgtccgggccaagtacctccgcgcaatcgcggccaagataatcgagaggaaatctgagctggctagactagagacgcttgattgtgggaagcctcttgatgaagcagcatgggacatggacgatgttgctggatgctttgagtactttgcagatcttgcagaatccttggacaaaaggcaaaatgcacctgtctctcttccaatggaaaactttaaatgctatcttcggaaagagcctatcggtgtagttgggttgatcacaccttggaactatcctctcctgatggcaacatggaaggtagctcctgccctggctgctggctgtacagctgtactaaaaccatctgaattggcttccgtgacttgtttggagcttgctgatgtgtgtaaagaggttggtcttccttcaggtgtgctaaacatagtgactggattaggttctgaagccggtgctcctttgtcatcacaccctggtgtagacaaggttgcatttactgggagttatgaaactggtaaaaagattatggcttcagctgctcctatggttaagcctgtttcactggaacttggtggaaaaagtcctatagtggtgtttgatgatgttgatgttgaaaaagctgttgagtggactctctttggttgcttttggaccaatggccagatttgcagtgcaacatcgcgtcttattcttcataaaaaaatcgctaaagaatttcaagaaaggatggttgcatgggccaaaaatattaaggtgtcagatccacttgaagagggttgcaggcttgggcccgttgttagtgaaggacagtatgagaagattaagcaatttgtatctaccgccaaaagccaaggtgctaccattctgactggtggggttagacccaagcatctggagaaaggtttctatattgaacccacaatcattactgatgtcgatacatcaatgcaaatttggagggaagaagtttttggtccagtgctctgtgtgaaagaatttagcactgaagaagaagccattgaattggccaacgatactcattatggtctggctggtgctgtgctttccggtgaccgcgagcgatgccagagattaactgaggagatcgatgccggaattatctgggtgaactgctcgcaaccctgcttctgccaagctccatggggcgggaacaagcgcagcggctttggacgcgagctcggagaagggggcattgacaactacctaagcgtcaagcaagtgacggagtacgcctccgatgagccgtggggatggtacaaatccccttccaagctgtaa</cdnaseq>

Protein Sequence

<aaseq>MATAIPQRQLFVAGEWRAPALGRRLPVVNPATESPIGEIPAGTA EDVDAAVAAAREALKRNRGRDWARAPGAVRAKYLRAIAAKIIERKSELARLETLDCGK PLDEAAWDMDDVAGCFEYFADLAESLDKRQNAPVSLPMENFKCYLRKEPIGVVGLITP WNYPLLMATWKVAPALAAGCTAVLKPSELASVTCLELADVCKEVGLPSGVLNIVTGLG SEAGAPLSSHPGVDKVAFTGSYETGKKIMASAAPMVKPVSLELGGKSPIVVFDDVDVE KAVEWTLFGCFWTNGQICSATSRLILHKKIAKEFQERMVAWAKNIKVSDPLEEGCRLG PVVSEGQYEKIKQFVSTAKSQGATILTGGVRPKHLEKGFYIEPTIITDVDTSMQIWRE EVFGPVLCVKEFSTEEEAIELANDTHYGLAGAVLSGDRERCQRLTEEIDAGIIWVNCS QPCFCQAPWGGNKRSGFGRELGEGGIDNYLSVKQVTEYASDEPWGWYKSPSKL</aaseq>

Gene Sequence

<dnaseqindica>147..255#355..497#1550..1630#1726..1874#2572..2664#2796..2919#3004..3069#3260..3326#4019..4095#4451..4564#4965..5042#5124..5275#5379..5439#5711..5817#5916..6006#agaacagagcactccctctcccaccaccactccacacctgacaccacgcgggctgcctccatcgtcatcgatccatctccgtatctctcaccgaccccaaatcgcacagctccagctcctcctcgatccccgtcgcgatcggcgagatggccacggcgatcccgcagcggcagctcttcgtcgccggcgagtggcgcgcccccgcgctcggccgccgcctccccgtcgtcaaccccgccaccgagtcccccatcggtaccctcctcttcaccctctccaccctctgcttctgcctctgattagcctttttgttgttgttgttgttgctgctgttttttgcgtgtcggtgcgcaggcgagatcccggcgggcacggcggaggacgtggacgcggcggtggcggcggcgcgggaggcgctgaagaggaaccggggccgcgactgggcgcgcgcgccgggcgccgtccgggccaagtacctccgcgcaatcgcggccaaggtagggtggtgactacccccacccccccccccccccccaacgcgacccgcgtgcgtgtgttccgtacagggggaggagctccgcgtggctctccagtaggtttttgagccccaaatcgatcgatatgctctagttttaagtttgctgcttaaattcctcaagggtttagtttgcaaccaaatccttattttagcttcggtataagccccccatatgatgtgcgtgcgtcggcatcggaagtgcgtatcctctgttctggactaggaattggccataggttgatcgacagttcgagtattctgcttctgtttggaataagttggaagcatggctgattgtgtatctggatgctgtttttgtggtgattcgtttcaagctcttgttaattgatgggttcaagcggagagggtgcgcaacaacaagtgtatatggctcacggccatgggtgtgcacatttgattggtgcgcaacaacaagtgtatattgtttgtgtgcttcgttagttggcaggtcctagtcactaaatcactattggattggtactagttacttttgtgccttgacgatgggactggattactagccttttggttgcctttgtggtattccgttgttatgggcctgttgatggatggatccctttaatttctagtgccaaatgcatgctagatttctcacagtttttctcttcaggttatatttctcgtatttccttttcctaaaggattgctttttcatgtattttctggcatatataggttattattattattattctccagaacaagattacccatattatggatcactagtgtacacttttttggatgaaaaacctacttactgaaagtaaaacagtgaccagtgcacactttacttgaactgtcaaaccatcaattttctagcaaagcaggggatgctagccttccagtctaaatgacagtaaactactatacttttgtccgtaggtttggaaatatgctaatttctatcataaaaattttcatggcatatgcgagcattttatgatcaccttttccctttttcttcagataatcgagaggaaatctgagctggctagactagagacgcttgattgtgggaagcctcttgatgaagcagcatgggacatggtatgtggccagttatccactgtatgaatatgtagttgcctacacagcaatctttcctgaacatgaatcctgatgtatgatattccatttgtcaggacgatgttgctggatgctttgagtactttgcagatcttgcagaatccttggacaaaaggcaaaatgcacctgtctctcttccaatggaaaactttaaatgctatcttcggaaagagcctatcggtgtagttgggttgatcacaccttggtatttcacatttttctctcatcctgcgcttatatttatttatgacccaagcatggtactaaatagtactagtaacatgcatatactgaatgagtttacaactttacatgatttttttgaactatgaaagttgaagacatttgagattttattcctcttctcttgtgcaaacatattattgtctcacaaattgtacctagcagctactctctccgtttcatattataagtcgtttgacttttttcctagtcaaaatgtgttaagtttgaccaagtttatagaaaaatttagcaacatctaaaatatcaaagtcatgttttagtgttttttcaggctctcatgtaagcaattttgatgtgccctctcctttcttcttaatataatgatacacagctcttgtgtattcaaaggaaaatatatatatatataatgatacacacctctcctccgtgttaatgcagctcatttgttctgtcccggttcaaatatctatttttctcatatgttgtcagcatgattcacttaatttagtatatagaagatgccattatttatgtctggaatcttactgcagaagggaaaacaattgataacggaattgattgcattctaatttgttgtttctttgttatgttcttatcgacaattacaaatttgattctgagaatcatgttcgggatgtgtatttctactgcaggaactatcctctcctgatggcaacatggaaggtagctcctgccctggctgctggctgtacagctgtactaaaaccatctgaattggcttccgtgtaagtttaacatgttaacttgttaatgtcatacccatgctagttgcaatgacatttgattttaaaatgttgtggcatgtccatgctgcaagcaatgtaatttgaaatctctctctatcattaattaccaggacttgtttggagcttgctgatgtgtgtaaagaggttggtcttccttcaggtgtgctaaacatagtgactggattaggttctgaagccggtgctcctttgtcatcacaccctggtgtagacaaggtacagctattcctcctgtaatcatgtataccccatcaatggaaatgatattcctctcaatacatggtttatgttttctgttaggttgcatttactgggagttatgaaactggtaaaaagattatggcttcagctgctcctatggttaaggtttgtttccaaatttctgtggatattttttgttctctttctactaactctctattatcaattctcaatgttgtccttttcttttaactcctttactttttagaattgtgatcaagacactttgagcatcattctagtagccagttctatcctgtttcttacctttttatggttcgtcttttcttgacagcctgtttcactggaacttggtggaaaaagtcctatagtggtgtttgatgatgttgatgttgaaaaaggtacatgccacttgctatgattaactaattctgaagtgcgggactttgtaaagcacttaactgagctggatgctagacccccaaaagccctttttggtgtcttgggcttgttgcagaaatactggtcccagacgagcaggatgcaagaaaattaactacttttgccactgattagtatttcttagaagttacacctcaaggattagcaatactttcttaaaatgtgctattgattaaaaagatgtcctgtattattttgagcagatcttgtactggttgatcggcttgcatgaaaatattgttgaggattataatgccatgccaactgagtaaagaaaagagttgtaaaatatgttatgcaacatgaatatatatgtgatttcatttttcctttttcttttcgtggcaaggaaggcagttaggaaggactgatgtgaaaagcacaagtactattcttagttctggaaaactgtgttctttattttcctaactacaattcaccttgattagtcagtaacttgatattggcaattctagctgattatgaattctgtttatatttcactaattttgaatctttaattacattttatggttgaaatttaacgttttgtctggttatggactctgtttgtattcactcaatttggatcttccattagatttcattgttggtccttcttcttgtacagctgttgagtggactctctttggttgcttttggaccaatggccagatttgcagtgcaacatcgcgtcttattcttcatgtaagcattgaatatatccgtcaatcataatctattgttgtacttgattttttttctgatcaactcctgagttcagattattatatgatgccattactattgcacagagcgaataaaattgtatttatgcacagcatgtattttgagtaatatatgcattgcctattatttaatatatagattgtagcacttaattttgtgtccatgtctctatgatgtttattactttattattgccggcatgaagcaactttgaactctatgttgatcttgaactaaaattgaaattaattggcttattgctattaatgatatagctttcagcttcttgctcctgaccatgaaagttttgcagaaaaaaatcgctaaagaatttcaagaaaggatggttgcatgggccaaaaatattaaggtgtcagatccacttgaagagggttgcaggcttgggcccgttgttagtgaaggacaggtaccacatgtaaactttttctaaattcaaaaaagaaatgccactgatcaatggtaggtccttccaagccttattgctggattgttgcactgttttgtcaattttgtgtaatatagttctgaatgaattagtcggtgtatgctcttgctagttgctagtatgtggtacagggtcttcctactttgagcaaattcgtgttaaaatgcattgatgaaaaggccacctttccgtaggtttatcttgtcataatttaaaccccaataaaattttaattttttgttttgaccccatggcactttaatgaaatcacttagccatgagcttttgtatatattttcaaagcaccagaatgtttagatggtttgttggaaatcttacacatcctattgccttgtgtcagtatgagaagattaagcaatttgtatctaccgccaaaagccaaggtgctaccattctgactggtggggttagacccaaggtaataatctactacacggttgtatatataggtacccacatatcattatgaagtagaaataatcttgtatgtttttgtcagcatctggagaaaggtttctatattgaacccacaatcattactgatgtcgatacatcaatgcaaatttggagggaagaagtttttggtccagtgctctgtgtgaaagaatttagcactgaagaagaagccattgaattggccaacgatactcagtgagttttttttttaatacagttcattgtcctgttcaatcttgcagcatatgtatatactctgtggcatatgaacttattctgctactactacttttgatagttatggtctggctggtgctgtgctttccggtgaccgcgagcgatgccagagattaactgaggtatatccaagtgaagggggttggcattgtttgattcatatgacatggttgcatcaagctgatattcaagaatctcatttattacttgcattctatgcatctccagttcttccctggactccggtcaatgttaatatagtttgtttgctagtagtatgctactccaattaagttgctcttcacttccacatcatctgatccatgactttatatttgaccccttttttttgcaaaagaaagggaaatacttaacgaaaatttcctactgcaggagatcgatgccggaattatctgggtgaactgctcgcaaccctgcttctgccaagctccatggggcgggaacaagcgcagcggctttggacgcgagctcggagaagggtgggtagcacacaacaatctcactttaaaacaccatttcgatcgtctgatgatctcgacctgacatcatgcctttggtattttcattcacttttcaggggcattgacaactacctaagcgtcaagcaagtgacggagtacgcctccgatgagccgtggggatggtacaaatccccttccaagctgtaatgtaatatgcgcatacgcatgacacgcccatctgttctgatcgtttggaataagaggccatagtatgacgggatggactttgtgcatatcgatgtttgatttgccatgtgctgagcctggaaataaaaaaggttatagttggagact</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0424500, RefSeq:Os08g0424500