Difference between revisions of "Os10g0567400"
(→Annotated Information) |
|||
| Line 1: | Line 1: | ||
| − | This gene locus named after ''OsCAO1'' of Oryza sativa Japonica Group, whose length is 2983 bps and 541 amino acids ,plays a major role in chlorophyll b biosynthesis | + | This gene locus named after ''OsCAO1'' of Oryza sativa Japonica Group, whose length is 2983 bps and 541 amino acids ,plays a major role in chlorophyll b biosynthesis. |
==Annotated Information== | ==Annotated Information== | ||
| Line 17: | Line 17: | ||
* Line 1C-039-43, in which T-DNA insertion occurred in the first intron of ''OsCAO1''; the direction of the gus reporter gene was the same.Genotyping our 30 | * Line 1C-039-43, in which T-DNA insertion occurred in the first intron of ''OsCAO1''; the direction of the gus reporter gene was the same.Genotyping our 30 | ||
| − | T2 progeny resulted in the isolation of 4 homozygous(Lanes 7 , 12, 18 and 27), 17 heterozygous(1, 3, 5, 6, 10, 11, 14, 15, 17, 19, 20, 21 23, 24, 25, 26, and 28, and 9), wild-type (Lanes 2, 4, 8, 9, 13, 16, 22, 29, and 30) segregating plants[1]. | + | T2 progeny resulted in the isolation of 4 homozygous(Lanes 7 , 12, 18 and 27), 17 heterozygous(1, 3, 5, 6, 10, 11, 14, 15, 17, 19, 20, 21 23, 24, 25, 26, and 28, and 9), wild-type (Lanes 2, 4, 8, 9, 13, 16, 22, 29, and 30) segregating plants<sup>[1]</sup>. |
[[File:Genotyping and GUS activity in progeny of Line 1C-039-43.jpg|Figure 3.Genotyping and GUS activity in progeny of Line 1C-039-43. Thirty plants were genotyped with primers a and b (upper), or primers a and RB (lower). The 0.6-kb genomicDNAbands are PCR product using primers a and b, if no T-DNA insertion; 0.4-kb bands are PCR products using primers a and RB, if T-DNA was inserted in first intron]] | [[File:Genotyping and GUS activity in progeny of Line 1C-039-43.jpg|Figure 3.Genotyping and GUS activity in progeny of Line 1C-039-43. Thirty plants were genotyped with primers a and b (upper), or primers a and RB (lower). The 0.6-kb genomicDNAbands are PCR product using primers a and b, if no T-DNA insertion; 0.4-kb bands are PCR products using primers a and RB, if T-DNA was inserted in first intron]] | ||
| − | * Line 1B-044-10, in which the Tos17 was inserted into the fourth exon of ''OsCAO1''.In genotyping its T2 progeny, we isolated three homozygous plants, all of which showed the phenotype of pale green leaves, stunted growth, and less tillering[1]. | + | * Line 1B-044-10, in which the Tos17 was inserted into the fourth exon of ''OsCAO1''.In genotyping its T2 progeny, we isolated three homozygous plants, all of which showed the phenotype of pale green leaves, stunted growth, and less tillering<sup>[1]</sup>. |
[[File:Genotyping of T2 progeny of Line 1B-044-10.jpg|Figure 4.(B), ND1064 (C) and 1B-025-43 (D). LTR2 is the 3' region-specific primer of Tos17.]] | [[File:Genotyping of T2 progeny of Line 1B-044-10.jpg|Figure 4.(B), ND1064 (C) and 1B-025-43 (D). LTR2 is the 3' region-specific primer of Tos17.]] | ||
| Line 29: | Line 29: | ||
---- | ---- | ||
| − | '''The expression pattern of ''OsCAO1'' was light-dependent'''[1] | + | '''The expression pattern of ''OsCAO1'' was light-dependent'''<sup>[1]</sup> |
During the reproductive development stages, its expression level was higher in mature than in immature panicles. | During the reproductive development stages, its expression level was higher in mature than in immature panicles. | ||
| Line 41: | Line 41: | ||
---- | ---- | ||
| − | '''Transcript levels of ''OsCAO1'' followed a circadian rhythm'''[1] | + | '''Transcript levels of ''OsCAO1'' followed a circadian rhythm'''<sup>[1]</sup> |
Because the expression pattern of ''OsCAO1'' was light-dependent, we examined whether its transcript level followed a circadian rhythm.Transcript levels | Because the expression pattern of ''OsCAO1'' was light-dependent, we examined whether its transcript level followed a circadian rhythm.Transcript levels | ||
| Line 77: | Line 77: | ||
==References== | ==References== | ||
| − | [1 | + | [1] Sichul Lee,et.al,''Differential regulation of chlorophyll a oxygenase genes in rice'',Plant Molecular Biology (2005),57:805–818 |
==Structured Information== | ==Structured Information== | ||
Revision as of 08:09, 1 June 2014
This gene locus named after OsCAO1 of Oryza sativa Japonica Group, whose length is 2983 bps and 541 amino acids ,plays a major role in chlorophyll b biosynthesis.
Contents
Annotated Information
Function
OsCAO1 plays a major role in chlorophyll b biosynthesis.Knockout mutant lines tagged by T-DNA or Tos17 have pale green leaves, indicating chlorophyll b deficiency.And the manifested phenotype was one of pale green leaves and retarded growth,besides those particular plants produced fewer tillers, usually 3–5 compared with 13–15 in the wild types[1].
Mutant
The schematic diagrams of the rice CAO genes and insertion positions of T-DNA and Tos17.
- Line 1C-039-43, in which T-DNA insertion occurred in the first intron of OsCAO1; the direction of the gus reporter gene was the same.Genotyping our 30
T2 progeny resulted in the isolation of 4 homozygous(Lanes 7 , 12, 18 and 27), 17 heterozygous(1, 3, 5, 6, 10, 11, 14, 15, 17, 19, 20, 21 23, 24, 25, 26, and 28, and 9), wild-type (Lanes 2, 4, 8, 9, 13, 16, 22, 29, and 30) segregating plants[1].
- Line 1B-044-10, in which the Tos17 was inserted into the fourth exon of OsCAO1.In genotyping its T2 progeny, we isolated three homozygous plants, all of which showed the phenotype of pale green leaves, stunted growth, and less tillering[1].
Expression
OsCAO1 is induced by light and is preferentially expressed in photosynthetic tissues.OsCAO1 was expressed strongly in shoots and leaves[1].
The expression pattern of OsCAO1 was light-dependent[1]
During the reproductive development stages, its expression level was higher in mature than in immature panicles.
When seedlings were grown under continuous light, they accumulated higher levels of OsCAO1 transcript than were measured in darkgrown plants.
When transferred dark-grown seedlings to light conditions,Within the first half hour after transfer, OsCAO1 transcript levels started to increase rapidly, reaching a maximum level in 2 h; when light-grown plants were transferred to dark conditions, OsCAO1 transcript levels decreased.
Transcript levels of OsCAO1 followed a circadian rhythm[1]
Because the expression pattern of OsCAO1 was light-dependent, we examined whether its transcript level followed a circadian rhythm.Transcript levels of OsCAO1 were higher during the daytime, but much lower in the late afternoon and at night.During the nighttime,OsCAO1 transcript levels were high.the change in expression for OsCAO1 was gradual, reaching a maximum level at 2 PM; its accumulation began in the dark.
OsCAO1 was inducible by all light treatments, but most significantly under blue light.
| Primer | Forward primer | Reverse primer |
| RT-PCR | 5'-tcaaccattggcatctcaaa-3' | 5'-cgtgatgctgtcgctagtgt-3' |
| DNA pool screening | 5'-tacagatcatgggattcaaaattggac-3' | 5'-ttacccactgctcctcaaaacaatcta-3' |
Evolution
This class of proteins (chlorophyll a oxygenase (CAO) protein) they encode contain two conserved functional motifs – the Rieske Fe–sulfur coordinating center and a non-heme mononuclear Fe-binding site.
Labs working on this gene
- National Research Laboratory of Plant Functional Genomics, Division of Molecular and Life Sciences, Pohang University of Science and Technology (POSTECH), Pohang 790-784, Korea
- Department of Molecular Biology, Pusan National University, Keumjung-ku, Pusan 609-735, Korea
- Department of Molecular Genetics, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan
References
[1] Sichul Lee,et.al,Differential regulation of chlorophyll a oxygenase genes in rice,Plant Molecular Biology (2005),57:805–818
Structured Information
| Gene Name |
Os10g0567400 |
|---|---|
| Description |
Rieske [2Fe-2S] region domain containing protein |
| Version |
NM_001071965.1 GI:115483525 GeneID:4349433 |
| Length |
3509 bp |
| Definition |
Oryza sativa Japonica Group Os10g0567400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 10:22938211..22941719 |
| Sequence Coding Region |
22938609..22938791,22938944..22939238,22939359..22939471,22939584..22939768,22939909..22940056 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008403:22938211..22941719 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008403:22938211..22941719 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgaccactgtggcatcgctgtctttgctgccgcacttgctcatcaagccttccttcaggtgttgctccagaaagggtgttggtagatatggaggaatcaaggtgtatgcggtgctcggtgatgatggagctgactatgcaaagaacaacgcatgggaggccttgttccatgtcgatgacccggggccaagggttccaattgcaaaaggcaagttcttggatgtcaaccaagctcttgaggtggtccggttcgatatccagtattgcgattggagggcgcggcaggacctcctcaccatcatggttcttcacaacaaggtggtagaggttcttaatcctttagcaagggagttcaagtcaattggaaccttgaggaaagagcttgcagaattacaggaagaattggcaaaagctcacaatcaggttcatctgtcggaaactagagtatcatctgcccttgataagttggcacaaatggagacccttgtcaacgacagactgttgcaagatggaggctctagcgcatctacagccgagtgcacttcccttgctccaagcacgtcatcagcgtcccgtgttgtaaacaagaaacctcctcgccggagtctgaacgtgtctggtccagtgcagccatacaatcccagtctgaagaacttctggtacccagttgctttctccagtgacctaaaagacgatacaatggtgccaatagattgttttgaggagcagtgggtaattttccgaggaaaggatgggagacctggatgtgttatgaacacatgtgctcacagagcttgccctcttcatcttggctcagttaatgagggcagaatccaatgcccttaccatggttgggagtattcaactgatggaaaatgtgagaaaatgccatccacaaagatgctcaacgtgcgcatccggtcattaccatgctttgagcaagaaggaatggtttggatatggcctggcaatgacccaccgaagtcgactatcccttctctgctgcctccttcaggatttacaattcacgcagagatagtgatggagctaccagtggagcatggacttcttctggacaatctattagatcttgctcatgctccttttactcatacatccacctttgccaagggttggagtgttccaagcttggtgaagttcttgacaccttcatctgggcttcaaggatactgggatccatacccgatcgacatggaatttcgaccaccatgcatggtgttgtcaaccattggcatctcaaagcctggaaaactagaggggaagagcaccaagcaatgttcgacgcatctccaccagctccatatctgtttgccctcctctaggaataaaaccaggctgctctaccggatgtctctcgacttcgctccatggatcaagcatgtccctttcatgcatatactatggtcacattttgctgagaaggtcttgaatgaggatcttcgactcgtgctcgggcagcaagaacggatgatcaatggcgcaaatgtctggaactggccagtatcatatgacaagcttggtatccggtatcggttgtggagagacgccattgagaggggagtagacaggttgccattcagtaaccaaagtgagagtggatcatag</cdnaseq> |
| Protein Sequence |
<aaseq>MTTVASLSLLPHLLIKPSFRCCSRKGVGRYGGIKVYAVLGDDGA DYAKNNAWEALFHVDDPGPRVPIAKGKFLDVNQALEVVRFDIQYCDWRARQDLLTIMV LHNKVVEVLNPLAREFKSIGTLRKELAELQEELAKAHNQVHLSETRVSSALDKLAQME TLVNDRLLQDGGSSASTAECTSLAPSTSSASRVVNKKPPRRSLNVSGPVQPYNPSLKN FWYPVAFSSDLKDDTMVPIDCFEEQWVIFRGKDGRPGCVMNTCAHRACPLHLGSVNEG RIQCPYHGWEYSTDGKCEKMPSTKMLNVRIRSLPCFEQEGMVWIWPGNDPPKSTIPSL LPPSGFTIHAEIVMELPVEHGLLLDNLLDLAHAPFTHTSTFAKGWSVPSLVKFLTPSS GLQGYWDPYPIDMEFRPPCMVLSTIGISKPGKLEGKSTKQCSTHLHQLHICLPSSRNK TRLLYRMSLDFAPWIKHVPFMHILWSHFAEKVLNEDLRLVLGQQERMINGANVWNWPV SYDKLGIRYRLWRDAIERGVDRLPFSNQSESGS</aaseq> |
| Gene Sequence |
<dnaseqindica>2929..3111#2482..2776#2249..2361#1952..2136#1664..1811#1290..1568#1104..1208#687..929#73..147#gaggaaaaatatggggagtatttgtgcgtttttatttttgtttttgggtcgcactgttcgatcgtagcatccatgaccactgtggcatcgctgtctttgctgccgcacttgctcatcaagccttccttcaggtgttgctccagaaaggtgagttcttcttgttgttccttgaatctgtttttgttgttgttgtttggcgattcttgaatttgttttggggtatctggcgatgggaggaaccatgtttcttgtttggtttttgggttcaggtggccattcttgatgaaaaactgagtgtttgagtttgagcagtgcaatggagttaccatttttgttcttctgattggattctttgtgatggttgatgtttttgttcagacaatggtttcaaggttctgtgattcttcagaccccatatcttaaaacctgttgtattgaagtaagcaaaaaaacaaatcttgatcaaggacagcctagttgccaatttttctttgcaaatctgaatgcaattcaatctctttcttccagcaaatgcgtgcagctttcccccagtaaccacaggcttatctctgacactgatttaactagattttgctaatctctttgatactagtttgtctgctaaaatagagtgcatgtgaggttgatgaaaattgatggtgaccttgctgattgaaactacacagggtgttggtagatatggaggaatcaaggtgtatgcggtgctcggtgatgatggagctgactatgcaaagaacaacgcatgggaggccttgttccatgtcgatgacccggggccaagggttccaattgcaaaaggcaagttcttggatgtcaaccaagctcttgaggtggtccggttcgatatccagtattgcgattggagggcgcggcaggacctcctcaccatcatggttcttcacaacaaggtaggaagcattggacaagtcacaagttcagagaagaggtcaaagctttcatagtctgaattttacagatcatgggattcaaaattggactgcatactgaataatgcttgaggttgaagtttcggatgactgacataggttaacttaaatgaatttttgaacattgaaatgcaggtggtagaggttcttaatcctttagcaagggagttcaagtcaattggaaccttgaggaaagagcttgcagaattacaggaagaattggcaaaagctcacaatcaggtattgtactttcaggagacaggagccaaatgaaaaacttcaatattatatggattctgatgttttacatgtctaatccaggttcatctgtcggaaactagagtatcatctgcccttgataagttggcacaaatggagacccttgtcaacgacagactgttgcaagatggaggctctagcgcatctacagccgagtgcacttcccttgctccaagcacgtcatcagcgtcccgtgttgtaaacaagaaacctcctcgccggagtctgaacgtgtctggtccagtgcagccatacaatcccagtctgaagaacttctggtacccagttgctttctccagtgacctaaaagacgatacaatggtaaaaacaacgtgcgattcaggcatttttttacgaggtcagagttagcagttgcagaaacttatgtttatttgatgtggtttgcgcattctcaggtgccaatagattgttttgaggagcagtgggtaattttccgaggaaaggatgggagacctggatgtgttatgaacacatgtgctcacagagcttgccctcttcatcttggctcagttaatgagggcagaatccaatgcccttaccatggtaagaaaagacagctttacatgaactttcatttctgcatgcttccgcatttatttctgaagtcttcagatgaaaatttgccaacagagagaagttgcgaaagtagtatttcagtttttttttgttttcataaccttcaggttgggagtattcaactgatggaaaatgtgagaaaatgccatccacaaagatgctcaacgtgcgcatccggtcattaccatgctttgagcaagaaggaatggtttggatatggcctggcaatgacccaccgaagtcgactatcccttctctgctgcctccttcaggatttacaattcacgcagaggtaaaaggagatcatgtcatgctgcagcaaccatactatgtggaactgtcctgtgcatttcaagatttttactggactgaaaagtaatggaattgttcttgatcatcaacagatagtgatggagctaccagtggagcatggacttcttctggacaatctattagatcttgctcatgctccttttactcatacatccacctttgccaagggttggagtgttccaaggtatttacatacatatattttcacagccatgtggaattcttttttttttttttagaaaatggatagccatgtggaaatgtcttcagaaatcatcatgctgatgctatgttcatttcccagcttggtgaagttcttgacaccttcatctgggcttcaaggatactgggatccatacccgatcgacatggaatttcgaccaccatgcatggtgttgtcaaccattggcatctcaaagcctggaaaactagaggggaagagcaccaagcaatgttcgacgcatctccaccagctccatatctgtttgccctcctctaggaataaaaccaggctgctctaccggatgtctctcgacttcgctccatggatcaagcatgtccctttcatgcatatactatggtcacattttgctgagaaggtgagtccgaaaaattcagagcaacttcatactaaactgttgtccatctcatgtcattacagtttgcacctgactatagtatgcggttacctttgttttgcatactgtcctctatacaacatctataataatcttgtatgatctttctgcaggtcttgaatgaggatcttcgactcgtgctcgggcagcaagaacggatgatcaatggcgcaaatgtctggaactggccagtatcatatgacaagcttggtatccggtatcggttgtggagagacgccattgagaggggagtagacaggttgccattcagtaaccaaagtgagagtggatcatagtagctgcattgccaatagcctcttttcaattcttgtcgtatttcttggcgagatgaagatgaagatgaagatgatgatggccagaactagtcagtggatgtatatgcacagtttgtttaggcgtgcgtccctgcatggttggttcaccatctccctgagcttcgttgcagattgaattgggttctggagaggaaaggctaatggaaggagagaatgataggcgacgtcattctgtgtaattttaagtgtacactagcgacagcatcacgggatgcaattgtaatctgaggttgatttgtttttcttcttttttttttcctccccttttacccatgtaaaagtcgatcgcatgtcacgctatgatgcatatatatgatcatactattgattattgagcc</dnaseqindica> |
| External Link(s) |






![Figure 10.Phylogeneic trees of the proteins containing the conserved Rieske [2Fe–2S] binding site from rice and Arabidopsis](https://ngdc.cncb.ac.cn/ricewiki/images/7/7b/Phylogeneic_trees_of_the_proteins.jpg)