Difference between revisions of "Os07g0102300"

From RiceWiki
Jump to: navigation, search
(Mutation)
(Mutation)
Line 13: Line 13:
 
that srl1-1 exhibited incurved leaves from the seedling stage to reproductive stage(Figure 1).
 
that srl1-1 exhibited incurved leaves from the seedling stage to reproductive stage(Figure 1).
 
In grass species such as rice, leaf rolling is induced by water loss from bulliform cells on the leaf upper epidermis, therefore the number and density of bulliform cells may affect the extent of leaf rolling. However, there has been controversy over the roles of bulliform cells in leaf rolling . Studies by Shield demonstrated that water loss from the adaxial subepidermal sclerenchyma and mesophyll also contributed to leaf rolling, and rolling could occur in leaves lacking bulliform cells. In our study, srl1-1 and srl1-2 mutants displayed adaxially rolled leaves resulted from increased number of bulliform cells on the adaxial side of leaf blades, which may substantiate the role of bulliform cells in controlling leaf rolling.
 
In grass species such as rice, leaf rolling is induced by water loss from bulliform cells on the leaf upper epidermis, therefore the number and density of bulliform cells may affect the extent of leaf rolling. However, there has been controversy over the roles of bulliform cells in leaf rolling . Studies by Shield demonstrated that water loss from the adaxial subepidermal sclerenchyma and mesophyll also contributed to leaf rolling, and rolling could occur in leaves lacking bulliform cells. In our study, srl1-1 and srl1-2 mutants displayed adaxially rolled leaves resulted from increased number of bulliform cells on the adaxial side of leaf blades, which may substantiate the role of bulliform cells in controlling leaf rolling.
 +
Overproliferation of bulliform cells resulted in the increased number of bulliform cells, while the total number of cells on the adaxial side of leaf blades did not change in srl1-1 and srl1-2, suggesting that more bulliform cells and less epidermal cells were formed from the early undifferentiated epidermis. Therefore, SRL1 may control leaf rolling by negatively regulating the formation of bulliform cells. In rice, the young leaf is adaxially rolled after differentiation from the leaf primordium, and unrolling occurs when the leaf blade emerges from the leaf sheath. The leaves of srl1-1 and srl1-2 continuously exhibit adaxial rolling after the emergence from leaf sheath, indicating the defects in regulation of unrolling. Compared with the thick and cutinized cell walls of epidermal cells, bulliform cells are large, thin walled, and highly vacuolated, and the increase of bulliform cells in srl1-1 and srl1-2 mutants may result in altered mechanical properties of the leaf adaxial surface, leading to adaxial rolling of leaves.
  
 
===Expression===
 
===Expression===

Revision as of 10:26, 1 June 2014

SEMI-ROLLED LEAF 1 (SRL1), a gene involved in the regulation of leaf rolling.

Annotated Information

Function

SRL1 is expressed in various tissues and is expressed at low levels in bulliform cells. SRL1 protein is located at the plasma membrane and predicted to be a putative glycosylphosphatidylinositol (GPI)-anchored protein.

Xiang et al. have demonstrated that SRL1 regulates leaf rolling through inhibiting the formation of bulliform cells by negatively regulating the expression of genes encoding vacuolar H+-ATPase subunits and H+-pyrophosphatase, which will help to understand the mechanism regulating leaf rolling[1].

Mutation

Figure 1.The leaves of srl1-1 are adaxially rolled from seedling to mature stage compared with those of wild-type plant Nipponbare (Nip).1, 14-d-old seedlings, bar = 1 cm; 2, 30-d-old plants, bar = 10 cm; 3, mature plants, bar = 10 cm; 4, section of the second leaf from top of mature plants, bar = 1 mm.(from reference [1]).

Mutants srl1-1 (point mutation) and srl1-2 (T-DNA insertion) exhibit adaxially rolled leaves due to the increased numbers of bulliform cells at the adaxial cell layers, which could be rescued by complementary expression of SRL1.Phenotypic analysis revealed that srl1-1 exhibited incurved leaves from the seedling stage to reproductive stage(Figure 1). In grass species such as rice, leaf rolling is induced by water loss from bulliform cells on the leaf upper epidermis, therefore the number and density of bulliform cells may affect the extent of leaf rolling. However, there has been controversy over the roles of bulliform cells in leaf rolling . Studies by Shield demonstrated that water loss from the adaxial subepidermal sclerenchyma and mesophyll also contributed to leaf rolling, and rolling could occur in leaves lacking bulliform cells. In our study, srl1-1 and srl1-2 mutants displayed adaxially rolled leaves resulted from increased number of bulliform cells on the adaxial side of leaf blades, which may substantiate the role of bulliform cells in controlling leaf rolling. Overproliferation of bulliform cells resulted in the increased number of bulliform cells, while the total number of cells on the adaxial side of leaf blades did not change in srl1-1 and srl1-2, suggesting that more bulliform cells and less epidermal cells were formed from the early undifferentiated epidermis. Therefore, SRL1 may control leaf rolling by negatively regulating the formation of bulliform cells. In rice, the young leaf is adaxially rolled after differentiation from the leaf primordium, and unrolling occurs when the leaf blade emerges from the leaf sheath. The leaves of srl1-1 and srl1-2 continuously exhibit adaxial rolling after the emergence from leaf sheath, indicating the defects in regulation of unrolling. Compared with the thick and cutinized cell walls of epidermal cells, bulliform cells are large, thin walled, and highly vacuolated, and the increase of bulliform cells in srl1-1 and srl1-2 mutants may result in altered mechanical properties of the leaf adaxial surface, leading to adaxial rolling of leaves.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Key Laboratory of Plant Molecular Genetics, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 200032 Shanghai, China
  • State Key Laboratory of Rice Biology, China National Rice Research Institute, Hangzhou 310006, Zhejiang, China
  • Department of Plant and Microbial Biology, University of California, Berkeley, CA 94720, USA
  • US Department of Agriculture/Agricultural Research Service, Plant Gene Expression Center, 800 Buchanan St, Albany, CA 94710, USA

References

  1. 1.0 1.1 Xiang J J, Zhang G H, Qian Q, et al. SEMI-ROLLED LEAF1 Encodes a Putative Glycosylphosphatidylinositol-Anchored Protein and Modulates Rice Leaf Rolling by Regulating the Formation of Bulliform Cells[J]. Plant Physiology, 2012, 159(4): 1488-1500.

Structured Information

Gene Name

Os07g0102300

Description

Conserved hypothetical protein

Version

NM_001065217.1 GI:115470166 GeneID:4342175

Length

9406 bp

Definition

Oryza sativa Japonica Group Os07g0102300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:133173..142578

Sequence Coding Region

133549..133628,133780..133824,134513..134656,139932..139943,140098..140343
,141324..141908,142034..142198,142364..142412

Expression

GEO Profiles:Os07g0102300

Genome Context

<gbrowseImage1> name=NC_008400:133173..142578 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:133173..142578 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggatggcccccgccggtcgcctcctcctcatctcctgcctcctctgtgtgcccaattcatttggatttgcatttgctgtggaggaggaggaggacggcagcgggctgatgccacagctctcacccaccggctctcccaaccccttggttcccttcctcgcgcccgcccctctcgcgccattcttcaacaccacccctcctaacttgtcaggcaagtgctcattgaattttactgctgtcggtgacctcatcaccaccactgctgtcgactgctttgcgtccttcgccccgttcctcgccaatgtcatctgctgcccccagctccaggccatgctcaccatcctcattgggcagtccagcaagcagactggctcccttgctttggatcccaccgtcgctacctactgcctctccgatgttcagcagctattgttgagccagggcgctagtgatgagctccacaacatttgctcccttcacctctccaatgtcaccgagggatcatgccccgttagcaccgtcgatgcctttgaagctgtcatcgactcctcaaagctcctcgaggcctgtcacaagattgatcctgtcaacgagtgctgcagccgcacctgccagaatgctatcaacgatgcctcccagaagatctctttcaaagacggcggtttgacaagctacgctggtagccccaaagttgatagctgcaggaatgtcgtgctcagatggctatccagtaggcttggcccatcatctgcaaagcaaatgctcaggcagatatctaactgcaatgtcaatggagtttgtccactaagctttccagacacgagtaaagtggcaaaagagtgcagtggaactgtcaagaatggtacttcatgttgcaaggctatggacagttatgtatctcacttgcaaaagcaaagcttcataacaaatttgcaagctttagattgtgcccaattccttggtgacaagttgcaaaagatgaatgtcagtatgaatgtttatagctcatgtcagataactctcaaggacttttctcttcaagttggatctcaagaatctggatgccttcttccaagtatgccctcggatgcatcttttgacccagctactgggattagtttcacatgcgatctgaatgataatattgctgccccatggccatcttctatgcaagcatcgtcttcttcatgcaataaatctgttaatattccagagagacctgctgcgacatcggcacaaaatggtgtcaaccagaacagactggagcttagcctacttatttatctgggcacccttgttgttgctatttggctacaagtctag</cdnaseq>

Protein Sequence

<aaseq>MGMAPAGRLLLISCLLCVPNSFGFAFAVEEEEDGSGLMPQLSPT GSPNPLVPFLAPAPLAPFFNTTPPNLSGKCSLNFTAVGDLITTTAVDCFASFAPFLAN VICCPQLQAMLTILIGQSSKQTGSLALDPTVATYCLSDVQQLLLSQGASDELHNICSL HLSNVTEGSCPVSTVDAFEAVIDSSKLLEACHKIDPVNECCSRTCQNAINDASQKISF KDGGLTSYAGSPKVDSCRNVVLRWLSSRLGPSSAKQMLRQISNCNVNGVCPLSFPDTS KVAKECSGTVKNGTSCCKAMDSYVSHLQKQSFITNLQALDCAQFLGDKLQKMNVSMNV YSSCQITLKDFSLQVGSQESGCLLPSMPSDASFDPATGISFTCDLNDNIAAPWPSSMQ ASSSSCNKSVNIPERPAATSAQNGVNQNRLELSLLIYLGTLVVAIWLQV</aaseq>

Gene Sequence

<dnaseqindica>8951..9030#8755..8799#7923..8066#2636..2647#2236..2481#671..1255#381..545#167..215#aggttttgctgctgtccgcctgcctgcctactttctccacttttttctcctcctcctcctcttcttcttccttcgtttcgcctcctctactcttctaagttccaacttccaactagctcgactcaagtgaagagtccgccgcctttccctcctcgccgccgctcggatggggatggcccccgccggtcgcctcctcctcatctcctgcctcctctgtcagtagtttgcctcttgatccctcctctgtttcctttcctttccagtttcccatgcatttcttctctgtttcaccaaatctaattgggttgtttcttgattttgatctgtatgtgtgtggccactgctctgaatccgttaattaaataaatataaatgcgcaggtgtgcccaattcatttggatttgcatttgctgtggaggaggaggaggacggcagcgggctgatgccacagctctcacccaccggctctcccaaccccttggttcccttcctcgcgcccgcccctctcgcgccattcttcaacaccacccctcctaacttgtcaggtacccttaattacctctcctccttcgatcttcttacacttctcttataggagtataatatataggagtattaattaattaagagtacaaataagtaattgccaatgtaattttggtggatgcaggcaagtgctcattgaattttactgctgtcggtgacctcatcaccaccactgctgtcgactgctttgcgtccttcgccccgttcctcgccaatgtcatctgctgcccccagctccaggccatgctcaccatcctcattgggcagtccagcaagcagactggctcccttgctttggatcccaccgtcgctacctactgcctctccgatgttcagcagctattgttgagccagggcgctagtgatgagctccacaacatttgctcccttcacctctccaatgtcaccgagggatcatgccccgttagcaccgtcgatgcctttgaagctgtcatcgactcctcaaagctcctcgaggcctgtcacaagattgatcctgtcaacgagtgctgcagccgcacctgccagaatgctatcaacgatgcctcccagaagatctctttcaaagacggcggtttgacaagctacgctggtagccccaaagttgatagctgcaggaatgtcgtgctcagatggctatccagtaggcttggcccatcatctgcaaagcaaatgctcaggcagatatctaactgcaatgtcaatggaggtaccccctcaaactagcaacttcaatctactaccggcctttacaatgccatcagccagtatgttatgttctttacaatagaccacacaccctgctcctgatctatattgcttagcatttatttagcttagttattatttagtccctctataaatcaaactgttagaagtgcaccagtctgttctcacatcttgccctgtgtagtttgcaactgtattcatgtaaacttgctttcacgtgtcactatatagcactatcccctgcaagttagattgatttagttgagtttatataggctatagggaatcaatgttggtatgtaagtatcaaactgatagaaagaccattgattcagacaagcaccaaagagggaaaaattagttcaagttgatggacgcataagaataaaatagctcactcttactgtcttacatgaccataaaggtatgcaagtgctgcagacagatcctttggatttaagggcggcagttgattttcttccaaagagaacaccgtaatttaaagcaaagcactaaacaatccatacatgatatatctacatctaagcatagtctcttgtgtccatgtgggtctttcggaacactttgctgccattggaagttgactgcatggaactcaataggagccttagttctttacttcaagtatctaggtcagtgctatcataatatgctaggttctgaaaacatgtgggccgttgccacttatattaggtctgatggatctcagatgtatgaactggatggaaataataagaatctttagtacactagaactgtcatgtatgtacattgaacaagttacagaaattttctgtacctagtctttatgacaaattgtatttttcttttttttatcaccatcattttaacataagcaattatgtcttaagttttgttctcactgttcagtgcttgtgttctttatgctgagaaattgtttgcgtttcaactctccagtttgtccactaagctttccagacacgagtaaagtggcaaaagagtgcagtggaactgtcaagaatggtacttcatgttgcaaggctatggacagttatgtatctcacttgcaaaagcaaagcttcataacaaatttgcaagctttagattgtgcccaattccttggtgacaagttgcaaaagatgaatgtcagtatgaatgtttatagctcatgtcagataactctcaaggacttttctcttcaaggtaagttagaaaagaacattcagttgtttgtgcattaagatcatattttaaatgtcatttgtgtatttcttggaaactgaattgatggagtttctttccgtcgttcaacttacgtgtttgaccgattggaccaccctgctgatttgacaaacagttggatctcaaggtatgtgaacattttcaattatttttaccggtcatataacagtttatattaacgagagtatgtgcatcttcagttcttctgtttgactagcctagcattggtagaaaaatttttggaaatatacttgtttttgactggaattgcaagaataggctgattaggggaagttttgcggaaatatactggtgtcgcgccttgaatgagcgagagagcgatatcacgtaaaccatgcgcgaaagcggcggcgctatcgctaattgagagagagagagagagaggggtaatgcgtcggtctcgcattcggaaagcgcgagaacgaagcggtatcgcacttttgtaaatcgaaagcgtgggccgtccgacgccgcctgacgtacgcgggccacgaagcggtctcgagctttgagtgcgcgataacgcgtgcggtatcgctgtcggctcgcgcgagaccgtagtggcgggggccgtctgacgcacgtgaggcccggagcagtctcgcgctatgcgccagcgagagcgcggtcggtctcgcgctttgcgcgaacgagagcgccagcggtatcgcggtcggctagcgcgataccgttgcggcgtggcccacccccctaatcggctgataatcccgtaggtggcgacagcaacggcttcggtcaatatcgcgcttcgggagcgcgagagcggtcagctaattgcgcatgcaaatcaggtgcaagtcgttaatatttcatgagccgttgctatgtagaaagtataattttttttcatatttttttattatgtgtgcaacatatatacataaatgaacatgagaatatgtatatattgaaaataggcaaagattgtgtacgcggctatgagaagaaaaataaatatcttggaatttgcaaaataatgatatcagttacagatacatataggaaagaaacaatatattacctatagaaaaatagaaattgaatatatatttattaaaaatatataaaggagtagagagatcattcaagagcaatttttacaaagttaacaaagaatatgaatttagaatatgtcatattcacagagaaaatcacatttgcatattcatagactcggatcttatgacaagaaccgtgtagcgagttaacgaactacctagttcttgccacaagatcgggcctaagaatatgcaacaccgagtttatgaatttgcagtagtaggtcatattcacaaaaggacgctggaacttgaaaaaaagagtgggtgtaagaatgtattaaaaaaatcacatttgtatattcatagactcgatcttagggcaggaaccgtgtagcgagtgaacgaacaagatagagcgagttcaccaactactcagtttttgcctcaagattgggcctaagaatatgcaacacgaagttggaaccagcagaacgtttatggagaagagatgtagttgtgtgctaggtttggttatttataggggatgggaagaagctgcgcgtagtctcaattattagaaagagatgacgacgcgtcggactgcttcactaatcaatccaataattacaaagagaggacgcactttcggcgcatcagactgtttcactcgtgaagttactaattacaaagggacacaggtttcttcagtcatgccatgcctatcgagaaaagtgattggacactgtcactttcggcggcacatgctgcttcttgttttctttagttattacaaagcgacgacggcactttcggcgcggcggaatcttcactgttaaatgtgaatgattgattctctgtgaaatgtcccgtgattggaaagagaggatgccattttaggtgcgtatgattgtatctctgtgaaaagaaattagtgtgtaatgtaagtcatagtagtaaaaaataaaagtaatatccaatttgaatcgcacgagtaacatcgaaactgcactattaatttaattagtgagactataatttgtgttagctgtcatacgaaaaattattagttaaccaaaaatcatgtgttaactgcctgcaaaatagggcgtaaaaatatgatatatttcggaactacgaaacattgtacataacatgaagaataaccagtacaaagaaataatgttcactgctagtaatagaaagccaaaagcataacaaggtccagttaggtttgccagcgaacttaaagacataatgttcacttctactcgtcatcattgttagtcatagtcctagatgttccagctcgcttttttgtagtctttttccttgctcctgcggcatgtcgagggcctgagattgacagacggtttagctcatggcgctcacggttagatcgacgcgggtcattgttgtttccttctaaatcgccaacctctggttgtgtgggctgtcacctgggcgcatcaacaatttgcgaagcccaaagctcattgggtaccgatgacgaccctccaccgaagctagacatgtcgccgtacgatgccgtgtaaggcatctgactgcttgcacccgaggatccagacgagcgaggactacccactattgagtaaatatatgatatgcagctagcacccttgactcacttgacggtactactcgcattgaaatattttgttgcatcggtttgtcgttatacatgggcttgcactttcttacattgttgctaccttccatgcagaccgatattgcaggggagttagtaagggatgcgaaaactttgtgggagaagcttagagatggtatcgcgggtactaaccaggaagttatagccgcggttgactccctccgtagaaaaggtaagcgaatcatgcggctcgcatcgtgccgacattcctcggacgtctatactctggcaacatcaaggacgttcgagccaatgccggagcgtccctctacctcttcccggccgtccacctcagcccagccttcagcctccgcgcgacgatccaatgatggtcgggctacaggaaggtcaacttcgtttcgtgaggcacccattattccgataaattatgtagaaacttgaggtagaacctagtgggtgtagaatttatcagaatagtgggtgcctcacgaaacgaagttgacattcctgtagcccgaccatcattggatcgtcgtgcggaggctgaagggtgggctaaggtggacggccgggaagaggtagagggacgctccggaattggctcgaacgtccttcttgatgttgccgagtatagacgtctgaggaatgtcggcacgacgagagctgcatgattcgcttaccttttctacggagggagtcgaccgcggccataacttcctggttagtacccgcgataccatctctaagcttctcccacaaagttttcgcatcccttactaactcccctgcaatatcggtctgcatggaaggtagccacaatgtaagaaagtgcaagcccatgtataacgacaaaccgatgtaacaaaatatttcaatgcgagtagtaccgtcaagtgagccggagggtgctagctgcatatcatatatttgctcaatagtgggtggtcctcgctcgtctggatcctcgggtgcaagcagccggatgccttacacagcatcgtacgacgacatgtccagcttcggtggagggttgtcatcggtatccaatgagcttcgggcttcgcaaactgttgatgcgccccaggtgacagcccacacaaccagaggttagtgatttagaaggaaacgacaatgacccgtgtcgatctaaccgtgagcgccatgagccaaaccgtgtgtcactctcaggccctcgacatgccggaggagcaaggaaaagactataaaaaagcgagctggaacatctagaactatgactgacattgatgacgagtagaagtgaacattatgtctttaagttcgctggcaaacctaactggaccttgttatgcttttggctttctattactagcagtgaacattatttctttgtaccggttattcttcatgttatgtacgatgtttcgtagttcctaaatatatcatatttttacgccctattttgcaggcagttaacacatgatttttggttaactaataatttttcgtacgacagctaacacaaattatagtctcactaattaaattaatagtgcagtttcgatgttactcgtgcggttcaaattggatattacttttactttttactactatgacttatattacacactaatttcttttcacagagatgcaatcatacgcacctaaaatggcatcctctctttccaatcacgggacatttcacagagaatcaatcattcacatttaacagtgaagattccgccacgccgaaagtgccgtcgtcgctttgtaattactaaagaaaacaaagaagcagcatgtgccgccgaaagtgacagcgtccaattacttttctcgataggcatggcgtgactgaagaaacctgtgtccctttgtaattattaacttcacgagtgaaacagtctgacgcgccgaaagtgcgtcctctctttgtaattattggattgattagtgaagcagtccgacgcgccgtcgtctctttctaataattgagactatgtgcagcttcttcccatcccctataaataacaaccaaacctagcacacaactacgctatttcacatcgcgatatcgccatgttatcgcacttccaaacagcgaacatcggtatcacacagcgatacccatggtatattcccgcaaaaccttcgcaatccggtatatttttgcaaaatcatccgataaacagtatattttcaaaaaaatttcagcattggtagtggtaaggaaatctttgctatgtgagggaagtctatttattctgtcaaaataaatgaagtcattttcaccttgcccaaaacaaaatcaggaaaaggaaccgaactctgaatattctttcctgtccactaacctagctaggtgagggtgggaaaagaaaccattctaccctacatttctgaatattgggctgctcattttgattttgttaagggattgtaaaatgatcatgatttgcttggcgtgggagttagtacatgaattagattgatcagcttgtaccaattgtttaactgaacttgtttttatagcaaagtgctgcttttttagtctgcattgtagatttacgttgtgttaccttgacaaaattctattatactgaccaaactgtatgcaatagcgtttttgaggcttcactagctacattgaatttaaccttgtcaacttgtgaattgcgtatcaattgattgcattaattgttcctgattagtttttttatcgttttatgcagaatctggatgccttcttccaagtatgccctcggatgcatcttttgacccagctactgggattagtttcacatgcgatctgaatgataatattgctgccccatggccatcttctatgcaagcatcgtcttcttcatgcaataaatgtatgttgtatatctattgatcatgtattcctatgcgctagttgtatttacatgtttacgcacgtgcgccttttttgttgtttcttaggctccttttggatcataggaaaagtttcctgatccctgcaggaattgaactattttaaagtgaatttaatgccaaattcctatgttgcagacaggtccaaaaaaagttactcagccaaatagattagttgtgagcttaaaagttgaacccttctttaattcatctactgttatttttctaccttcttctgtaaaaacaatatgcaattaagtctgagttgccaattctatggtagagtgtaaaatattccccttgattccctcgctaaaaaaattttaaaaccttctgtttctatgttgctgcttcctcttttttattttttttgatcattttgaagaaagttgtggattttttttttcacttgttgagggcatcctcttcttctgggaaagaaacctctttgatcaataaattgcttgtctctatacagcttttgtcctggctttttaggttctgattttttagcggttctagcaaagctgtagtgacacctttacagttgcatggtgtcacaagcttcttgtggtgcttgaatgtatgtgctctgttgcttttatttattttaggttctcactgtaagttctgttattttgtattcagctgttaatattccagagagacctgctgcgacatcggcacaaaatggtaaggcaacatgtttatttttctctatccattccgtggaaacagtattcaacaatcaacactatacttgagctatgatatatctctgaatcagtataggagctttatattttgtggtcatatgaattaaaggtgatgtttcctgtcgcaggtgtcaaccagaacagactggagcttagcctacttatttatctgggcacccttgttgttgctatttggctacaagtctagtccagttagcgaattattaatttcagattcaggagagctgattggaattgtcaactgcggagtttttgtgcttgatgatcacatcaaagtgttgtaggttacatgtgctttttagttcctgatagctgttagtgtaatttcttgtaagccatataatagtagtaataatttattatgcctttgtatagagagaaagaagggaaaaaaattaaagggtgtgaaatgcgcaggacaatttagcaagaccactgttgtctgatgggagtacatcatattgggatggactacactccattattgtttagaatttatattattcaattgttcattttctgatgtatgaattaatcatgacagagaatcatataatctcatc</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0102300, RefSeq:Os07g0102300