Difference between revisions of "Os06g0569500"

From RiceWiki
Jump to: navigation, search
(=Expression)
(=Expression)
Line 6: Line 6:
  
 
===Expression==
 
===Expression==
[[File:1.jpg]]
+
[[File:1.png|right|thumb|150px|]]
 
Degradation of active C19-gibberellins (GAs) by dioxygenases through 2β-hydroxylation yields inactive GA products.We identified two genes in Arabidopsis (''AtGA2ox7'' and ''AtGA2ox8''),using an activation-tagging mutant screen, that encode2β-hydroxylases.GA levels in both activation-tagged lines were reduced significantly, and the lines displayed dwarf phenotypes typical of mutants with a GA deficiency.Double loss-of-function ''Atga2ox7 Atga2ox8'' mutants had twofold to fourfold higher levels of active GAs and displayed phenotypes associated with excess GAs, such as early bolting in short days,resistance to the GA biosynthesis inhibitor ancymidol, and decreased mRNA levels of AtGA20ox1,a gene in the GA biosynthetic pathway.The GA biosynthetic pathway can be classified into three stages. In the first stage, geranylgeranyl diphosphate is cyclized to ''ent-kaurene'' by copalyl diphosphate synthase and ''ent-kaurene'' synthase. In the second stage,''ent-kaurene'' is oxidized by ''ent-kaurene'' oxidase to ''ent-kaurenoic'' acid, which in turn is oxidized by ent-kaurenoic acid oxidase in three steps to GA12<ref name="ref5" />.
 
Degradation of active C19-gibberellins (GAs) by dioxygenases through 2β-hydroxylation yields inactive GA products.We identified two genes in Arabidopsis (''AtGA2ox7'' and ''AtGA2ox8''),using an activation-tagging mutant screen, that encode2β-hydroxylases.GA levels in both activation-tagged lines were reduced significantly, and the lines displayed dwarf phenotypes typical of mutants with a GA deficiency.Double loss-of-function ''Atga2ox7 Atga2ox8'' mutants had twofold to fourfold higher levels of active GAs and displayed phenotypes associated with excess GAs, such as early bolting in short days,resistance to the GA biosynthesis inhibitor ancymidol, and decreased mRNA levels of AtGA20ox1,a gene in the GA biosynthetic pathway.The GA biosynthetic pathway can be classified into three stages. In the first stage, geranylgeranyl diphosphate is cyclized to ''ent-kaurene'' by copalyl diphosphate synthase and ''ent-kaurene'' synthase. In the second stage,''ent-kaurene'' is oxidized by ''ent-kaurene'' oxidase to ''ent-kaurenoic'' acid, which in turn is oxidized by ent-kaurenoic acid oxidase in three steps to GA12<ref name="ref5" />.
  

Revision as of 12:53, 1 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Gibberellins (GAs) are a group of diterpene-type plant hormones biosynthesized froment-kaurene via ent- kaurenoic acid. GAs are ubiquitously present in seed plants. The GA signal is perceived and transduced by the GID1 GA receptor/DELLA repressor pathway[1].All higher plants contain an ent-kaurene oxidase (KO), as such a cytochrome P450 (CYP) 701 family member is required for gibberellin (GA) phytohormone biosynthesis. While gene expansion and functional diversification of GA-biosynthesis-derived diterpene synthases into more specialized metabolism has been demonstrated, no functionally divergent KO/CYP701 homologs have been previously identified. Rice ( Oryza sativa) contains five CYP701A subfamily members in its genome,despite the fact that only one (OsKO2/CYP701A6) is required for GA biosynthesis [2].Therefore,The Rice dwarf virus (RDV), a member of the genus Phytoreovirus,causes dwarfed growth phenotypes in infected rice ( Oryza sativa) plants. The outer capsid protein P2 is essential during RDV infection of insects and thus influences transmission of RDV by the insect vector.P2 of RDV interacts with ent-kaurene oxidases, which play a key role in the biosynthesis of plant growth hormones gibberellins, in infected plants. the P2 protein of RDV interferes with the function of a cellular factor, through direct physical interactions, that is important for the biosynthesis of a growth hormone leading to symptom expression.P2 may provide a novel tool to investigate the regulation of GA metabolism for plant growth and development[3].GAs are biosyn-thesized from geranylgranyl diphosph ate, which is converted to ent-kaurene by 2 terpene syntheses, ent-copalyl diphosphate synthase, and ent-kaurene synthase, in plants.Then ent-kaurene is converted to GA12 by two cytochrome P450 enzymes, ent-kaurene oxidase (KO) and ent-kaurenoic acid oxidase (KAO). KO locates in the outer membrane of the plastid, and KAO locates in the endoplasmic reticulum[4].

=Expression

1.png

Degradation of active C19-gibberellins (GAs) by dioxygenases through 2β-hydroxylation yields inactive GA products.We identified two genes in Arabidopsis (AtGA2ox7 and AtGA2ox8),using an activation-tagging mutant screen, that encode2β-hydroxylases.GA levels in both activation-tagged lines were reduced significantly, and the lines displayed dwarf phenotypes typical of mutants with a GA deficiency.Double loss-of-function Atga2ox7 Atga2ox8 mutants had twofold to fourfold higher levels of active GAs and displayed phenotypes associated with excess GAs, such as early bolting in short days,resistance to the GA biosynthesis inhibitor ancymidol, and decreased mRNA levels of AtGA20ox1,a gene in the GA biosynthetic pathway.The GA biosynthetic pathway can be classified into three stages. In the first stage, geranylgeranyl diphosphate is cyclized to ent-kaurene by copalyl diphosphate synthase and ent-kaurene synthase. In the second stage,ent-kaurene is oxidized by ent-kaurene oxidase to ent-kaurenoic acid, which in turn is oxidized by ent-kaurenoic acid oxidase in three steps to GA12[5].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0569500

Description

Similar to Ent-kaurene oxidase 1 (Fragment)

Version

NM_001064440.1 GI:115468611 GeneID:4341343

Length

6995 bp

Definition

Oryza sativa Japonica Group Os06g0569500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:22898131..22905125

Sequence Coding Region

22898131..22898642,22898989..22899157,22899243..22899497,22899652..22899792,22899893..22900051
,22901401..22901561,22904990..22905125

Expression

GEO Profiles:Os06g0569500

Genome Context

<gbrowseImage1> name=NC_008399:22898131..22905125 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:22898131..22905125 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagtcgatgctcgtagccggagcgggcgcggcggcggtggcggccgtcgggggcctcgtcgcggcggccgcgctcgccgacaagctcgtcgcggcgccgccgccgcgcaagaaccgcgccaacccgcctccagctgttcctggtttacccattattggaaatctgcatcaattgaaagaaaagaagcctcatcagacgtttgcaaaatggtctgaaacttatggaccaatctacactataaagaccggagcttctccagtggttgtgctcaattcaactgaagtagccaaggaggcgatgattgacaaattctcatccatatctactcgaaagctaccaaaagcaatgtctgtgctaactcgtaaaagtatggtcgcaatcagcgactacggtgactaccaaaagatggcgaagcgtaatattatgattggcatgttaggttttaatgcacagaaacagtttcgcggtacaagagagaggatgatcagtaacgtgttaagcactttgcataagttggtttctcttgacccacattcccctctgaacttcagggatgtttacattaatgagctgttcagcttgtccttgatccagagtttaggtgaggatgtgagttcagtttatgtggaagagtttgggagggagatatccaaggacgaaatctttgatgtccttgtgcatgagatgatgatgtgtgcagttgaggctgactggagggactacttcccctacctcagctggcttccaaacaagagcttcgacacaattgtgtctactacagaattcagacgagatgctatcatgaatgcattgatcaagaagcagaaggagaggattgcacgcggagaggcaagggcatcctacattgacttcttgctggaagctgagaggagtgcacagctgacagatgaccaactgatgctgctgctgtcggagtccatcctggctgcagctgatactgtcctggtgaccaccgaatggaccatgtatgagattgccaagaaccctgacaaacaggagctactctaccaagagatccgagaggcgtgcggcggcgaggcggtgaccgaggacgacttgccgcggctgccgtacctcaacgccgtgttccacgagacgctgcggctgcactccccggtgccggtgctgcccccgaggttcgtccacgacgacaccacgctcgccggctacgacatcgcggcgggcacccagatgatgatcaacgtgtacgcgtgccacatggacgagaaggtgtgggagtcgccgggggagtggtcgccggagaggttcctcggcgaggggttcgaggtggcggacaggtacaagacgatggcgttcggcgccgggaggaggacctgcgcggggagcctgcaggcgatgaacatcgcgtgcgtcgccgtggcgcgcctcgtgcaggagctcgagtggaggctgagggagggcgacggggacaaggaggacaccatgcagttcaccgccttgaagcttgacccgctgcatgtccacctcaagcccagaggaaggatgtga</cdnaseq>

Protein Sequence

<aaseq>MESMLVAGAGAAAVAAVGGLVAAAALADKLVAAPPPRKNRANPP PAVPGLPIIGNLHQLKEKKPHQTFAKWSETYGPIYTIKTGASPVVVLNSTEVAKEAMI DKFSSISTRKLPKAMSVLTRKSMVAISDYGDYQKMAKRNIMIGMLGFNAQKQFRGTRE RMISNVLSTLHKLVSLDPHSPLNFRDVYINELFSLSLIQSLGEDVSSVYVEEFGREIS KDEIFDVLVHEMMMCAVEADWRDYFPYLSWLPNKSFDTIVSTTEFRRDAIMNALIKKQ KERIARGEARASYIDFLLEAERSAQLTDDQLMLLLSESILAAADTVLVTTEWTMYEIA KNPDKQELLYQEIREACGGEAVTEDDLPRLPYLNAVFHETLRLHSPVPVLPPRFVHDD TTLAGYDIAAGTQMMINVYACHMDEKVWESPGEWSPERFLGEGFEVADRYKTMAFGAG RRTCAGSLQAMNIACVAVARLVQELEWRLREGDGDKEDTMQFTALKLDPLHVHLKPRG RM</aaseq>

Gene Sequence

<dnaseqindica>6484..6995#5969..6137#5629..5883#5334..5474#5075..5233#3565..3725#1..136#atggagtcgatgctcgtagccggagcgggcgcggcggcggtggcggccgtcgggggcctcgtcgcggcggccgcgctcgccgacaagctcgtcgcggcgccgccgccgcgcaagaaccgcgccaacccgcctccaggtaattaattaatccagctcgccgtgttcgtttcgatcgatcaaatgatcttctccaattggtttgatcctcactgctgctgtgtctcggtgttcgtcgtactctctccattgattgatctctgttggagatggcagtgtatgtggttagtttgttcgtcggaaaatatgtcgaattttctctgtttcagctagtgcgtaagctttttttttttgatggaatggtaatttctggtgtcgcaacaattagaaatgagcatgaatgatcagtttggcgtagataacaggatttgagctataacagcactcacggctgcgacagcacacctattgtgcacaaacaagtactccgccgttctaaaacataagtattttttttacatgtacacgatctccgagatgatactttaatcaacaatatctacaaaagtaaaatgtcttaaataaaaagagttgcatattatgatagttcgtttaatgataaatataataaaattaaatttacatgattaatcttttttaaaaagtttgacttagcactgttctaaaaatgcttatattttgggacagagggagtaatataaatggaggaggtggttagtggttttggcagatgtaaatatagtataattgtagtgtaattacattgtaacttacatataactacgatataaatttgaaccgttcgatttgctttaaaattcgcaagggatgtaggaaaaaatcacaacccactcacatgtgaggcgattcagtaccattacctccgttttcacataagtagcacatcacctagggatttttgaaaattacatactccctccgagctgatgatattagtcgctttaaataaggataaaatcaaaccttaaaatctttgactataaataatttctaaaatatttatcttaaaaaatgaaaaccatatatatatatatatatatatatatatatatatattagtcttaaaaagtacttcaataaaatcatatatttgttgatatttctatatatattataatagaaaatagttatcaaagctactctttggagactgtgcccttgtccaaaacgacaaatattattaacctggagggagtacaagttaaactatagttacatgtaagttacgttgtaattacatcacggtatttacacctatcaaattttttagcgaaaatttaacgacaaatgtatagctaatcccttaattttgatatattgcttgaaaatcgaattttccgaacagcaatttgtcgcgatggaccatataggaattaaagtggataatccaaatccactagattttattgaaactatatatcctaatcctaatactaatccgttggattttgaaaaaatacttaccatatctccgttcgattggattcagaacggatcagattgaaaagtgttaaatcatttttcatccttttttttttgagaaatcctttttttttctgtagtcctcggttcagttttgactgaatgtctgaaagggatgttgtttaattaacttgaaacagttcaaaattacaagcattcatgtctctgtcagttgaagtagccttctccttctcttctatatgttcgtcagactacttcagaaagtaggtacttcctctagtcacgaatatgttactgagaggctataactaaaaacacagtacctctgatttgtaatagataatgcccttaacatttgaaaatatgtttactcatccatcttatttatagaatttatataattattatttattttttgagttattttattattagaaatattttaagcataattcatatcttattcacttacccaaaatttttaaataagacgaatagtcaaacgtgtatcaaaaattaactgagccggagagaggatatctgaaactatgaaaagaggagcaattaaccatttcttccttaatccgcctgcatgcaacttgaaatcacaaaagcaaactcaagtcaatgccatggggaaaatttacagtagcccctgcttgcaggtaccaaaagaaaattgatcaatttcatgcaggtgtgaccaaagtactggattccaggcatagcacaagaacattccacggaagtaccacagcaaactcaatcaatcgttttacttggtccaaaagaattaagaaaactgtgcacctcttaacccattctaatgatgaggatccatttcctaattaaaggactttgttgtcaatcaattagactatattaataaagatgagccatttattttatcttttttttttttgaaaaatgttgaccagagaagagaaacatcccaaaggcattgccatcttacctgtatacggactctgttgccaccgttcttaaaaacttttaaaatgattttcattttctacggaaaagagtattaatgtagaatagtaaaaaaaatcattatcagtatttccgacggtggcggggagttatataatatatatttatgatgaattgtattcccctgcttttgttgaaacaaagtgttctttcaatatctcattcactattcatttgacttatatggattttaaaaataggcaatttatatgccataccgttatccattctgagcatggactaaatatttagaacgtaaattttgaacagactaaccttttagtgtgccggaactattaaaaaaaattaaagacttttattaatccataaaatatgtccgaaaatgtgttcttcagtttgttttcttctggttaagtatgcactggttctagttggcacatgtataatagttgtgattgcatatctattttgctgattaagagtaaacaaatggaaataactttctttgagttacgctttcagttaagattgttttgaaattattaatgtgcaaaatgaaagtagttattatagatcctttcagatatgtctatttcgatgagccactagtgcctgtgttgaaaatgcaaattattctagacaaattttgctagaggactttgtgacttcgtgattttagctgtatgacactgcacgaagtaactttgggggacaacactctataaacgtgaaaattgactcgtcgacaccgcttctattagaatattcattccaggttgaatatgagagtgaaatcatgtgaaagttctgaaatgcctctgagcctacatgtgaggtctaccatctctctatcactggccaaaatttcatcagatatttttagcttatttgattgtgtttactccatctgtccatcatctatccatgtacatagctagcattcttactgaaaaatgacccaataaaaggaaatatagaacctgtacatgttaaattacttgcttgaatgtttggtgttttcatttatgcagagacgaattaccaaaaacaaattaatttcagtccactacaagagctttagtaataacatcgttagttattgtaatgcagctgttcctggtttacccattattggaaatctgcatcaattgaaagaaaagaagcctcatcagacgtttgcaaaatggtctgaaacttatggaccaatctacactataaagaccggagcttctccagtggttgtgctcaattcaactgaagtagccaaggaggtatgcaagttgtcctttttcagcatttttttgttacctgttaatgttttcattttctttccgactacccaaattggtgtccccatatactctccactcttttacccacacttttcattcactgatatcctggactagcaccacaatttgctcgagctaagggtgctggtggtccatctttgttaggaaataaaataaaattatcatgactgttgcatcaagcaatgcatgtattcttacataattgtaactctggtgaccgcatactgttataaaatcaacctatccgacattacaactccaagtcttaaattataaccgactttatacacatattcgacacaaactctaacaaataaagtaataactaattcaatagaaacaaacatagacttatatggttcaaaatttaatcttagttttccccttttttttcaaaattttcacttaatctatctttagactcttttgaatttctattcaaacagataaaactctgaagagcaaggaattcaaaagagtacaaatatgtgatgtttttttttttaaaaaagatgaattcaaactgatgaaatttagaataaataggcaaggtttcagattgatcaactcgaaaaaaattgctctaaaatgctaaaacacgaatgaaggggtagttaaggacaaggaagcacacgtggttacagttgtaccattgtttttacgcttttcaaattatccttacacatgcaaaatagaggtgcttttagtatgatgtgtatgtaaattgcatggttttgacaatttcaaatgctatcctatccggttacttagtttacagttgatttttttacttgtgcaaaagtttagaattgtaagtggacatttctcttgataaattaaatgtgaatatcataattacaattaattcagatcagaaatgaaattaacctacaacatgaactctagagctaatatgatattattttttgtttctcttttttcgtggaggtaaaactgtaaacgctttggttcatgcaattgtgctatgatgttggcttctagttcatgacatgggtcctatgatgtttgatatgttttatcttccttattattcttggcttcaaggttgacatgtttgtatatgtttgtgcaaataccttgtttggaaagaaaataaaggcaatgtaaggaataacatcccaaagacttgaactctgtttgatcttcaatatatctaagtcttcaaaaaagaacttttatactacttttttcttactcttgcatagttacatatactcaataatgataatctcatattaattggtctgtaaataacaaaaacacatattctgtactactttttccaggcgatgattgacaaattctcatccatatctactcgaaagctaccaaaagcaatgtctgtgctaactcgtaaaagtatggtcgcaatcagcgactacggtgactaccaaaagatggcgaagcgtaatattatgattggcatgttaggttttaatgcacaggtacaaatctcagcaaaatttaaattcaatagtggattttgggtaccattagcactcagttaattgagctctaacaatgaaatgcttgcataaatttcagaaacagtttcgcggtacaagagagaggatgatcagtaacgtgttaagcactttgcataagttggtttctcttgacccacattcccctctgaacttcagggatgtttacattaatgagctgttcagcttgtccttgatccaggtttgtattacctctgaacttgaactctccagtggtccgtttgttacttccaatacctgtcatgattgttatgaacttataattgttgcaatttcgtagttactaggactgatcttgattgttatgaacttatatatatttgttacaatttcagagtttaggtgaggatgtgagttcagtttatgtggaagagtttgggagggagatatccaaggacgaaatctttgatgtccttgtgcatgagatgatgatgtgtgcagttgaggctgactggagggactacttcccctacctcagctggcttccaaacaagagcttcgacacaattgtgtctactacagaattcagacgagatgctatcatgaatgcattgatcaagaagcagaaggagaggattgcacgcggagaggtgacacaaaacttctattcgtatccaaaaataactttttttttctgcagatcatctgaactgaactgtaacgtattgcatgcaggcaagggcatcctacattgacttcttgctggaagctgagaggagtgcacagctgacagatgaccaactgatgctgctgctgtcggagtccatcctggctgcagctgatactgtcctggtgaccaccgaatggaccatgtatgagattgccaagaaccctgacaaacaggcaagaaattaactgatactacctccagttttattttttggtttcggacaacacatgttttagcatgttttctttgtaacttgtcgtaaacgtcaattaattttgtccggagggagtactttcaattatcttttgtatatactctttcttgtattgtattgtgatcctctgacataactttctcttgatatggtcattgacatgtcagcgatcatgtctctataactttacgagaaagaaagtcagaggatctcaatccctctttctttcaaatgcatttcagcattttgttgccaaccaaactaataaacaattgattgtttcttgttcttggcacatcgatcaggagctactctaccaagagatccgagaggcgtgcggcggcgaggcggtgaccgaggacgacttgccgcggctgccgtacctcaacgccgtgttccacgagacgctgcggctgcactccccggtgccggtgctgcccccgaggttcgtccacgacgacaccacgctcgccggctacgacatcgcggcgggcacccagatgatgatcaacgtgtacgcgtgccacatggacgagaaggtgtgggagtcgccgggggagtggtcgccggagaggttcctcggcgaggggttcgaggtggcggacaggtacaagacgatggcgttcggcgccgggaggaggacctgcgcggggagcctgcaggcgatgaacatcgcgtgcgtcgccgtggcgcgcctcgtgcaggagctcgagtggaggctgagggagggcgacggggacaaggaggacaccatgcagttcaccgccttgaagcttgacccgctgcatgtccacctcaagcccagaggaaggatgtga</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0569500, RefSeq:Os06g0569500

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. Cite error: Invalid <ref> tag; no text was provided for refs named ref5