Difference between revisions of "Os06g0665800"

From RiceWiki
Jump to: navigation, search
(Labs working on this gene)
(References)
Line 34: Line 34:
 
==References==
 
==References==
 
Please input cited references here.
 
Please input cited references here.
 +
<references>
 +
<ref name="ref1">Sichul Lee, Yu-Young Kim, Youngsook Lee, and Gynheung An*.  (2007)  Rice P1B-Type Heavy-Metal ATPase, OsHMA9, Is a Metal Efflux Protein. Plant Physiology: 831–842.</ref>
 +
<ref  name="ref2">Spielmeyer  W,  Ellis  MH,  Chandler  PM  (2002) Ryuichi Takahashi, Khurram Bashir, Yasuhiro Ishimaru, NaokoK.Nishizawa and Hiromi Nakanishi*. (2012) The role of heavy-metal ATPases, HMAs, in zinc and cadmium transport in rice. Plant Signaling & Behavior 7:12, 1605–1607.</ref>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 07:50, 2 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. Rice P1B-Type Heavy-Metal ATPase, OsHMA9, is a metal efflux protein. OsHMA9 is localized to the plasma membrane, and Cu, Zn, and efflux lead from the cells. The T-DNA insertion mutant alleles of OsHMA9 results demonstrate that OsHMA9 is required for conferring tolerance to high levels of Cu, Zn, and Pb. The mutants also showed some sensitivity to Cd, but not as significant as the other metals. 1.jpg

Subcellular localization of OsHMA9:GFP fusion protein (from reference [1]).

3.jpg

Isolation of OsHMA9 knockout plants (from reference [1]).

Expression

Please input expression information here. OsHMA9 were more strongly expressed in the roots of 30-d-old seedlings than in the leaves. The OsHMA9 mRNA level was higher in fully expanded mature leaves at the flowering stage compared with young leaves, suggesting that expression is increased as leaves senesce. OsHMA9 was weakly ex-pressed in the stems and were also more weakly expressed in the reproductive organs than in the vegetative tissues. The expression of OsHMA9de-creased in older panicles and seeds. 4.jpg

Expression analysis of OsHMA4--9 (from reference [1]).

Finally, in the case of OsHMA9,high concentrations of Cu, Zn, or Cd increased tran-script levels, but Pb had no effect. Therefore, might suggest that at least three OsHMAs (OsHMA5, OsHMA6,and OsHMA9) play roles in heavy-metal detoxification. In cross sections of the seminal roots, strong GUS activity was observed in the vascular cylinder. In the differentiation zone, where lateral roots develop, expression expanded to the cortex region, but was not detectable in young lateral roots. In the leaves and sheaths, GUS activity was as strongly detected in the vascular bundles as in the roots and was also detected in the mesophyll cells, but only weakly in the epidermal cells. Cross sections at the young microspore stage showed activity in both the anther wall and the microspore. At later stages, activity was mainly detectable in the anther wall. In cross sections of the subordinate portions, GUS activity was present at low levels in the ovary. These results demonstrating that OsHMA9 is strongly expressed in the stamens. 5.jpg

OsHMA9 promoter-driven GUS expression pattern (from reference [1]).

Evolution

Please input evolution information here. Rice possesses nine HMA genes and can be subdivided into two distinct clusters through phylogenetic analyses. Phylogenetic analysis showed that OsHMA1 through OsHMA3 belong to the Zn cluster, whereas OsHMA4 through OsHMA9 are part of the Cu cluster. The Cu cluster has members with a role in Cu and silver transport, whereas the Zn cluster proteins transport Zn and other heavy metals. 2.jpg

Phylogenic tree of HMAs from rice and Arabidopsis (from reference [2]).

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. Division of Molecular and Life Science, Biotechnolog y Research Center, Pohang University of Science and Technology, Pohang 790–784, Korea

References

Please input cited references here. <references> [1] [2]

Structured Information

Gene Name

Os06g0665800

Description

ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter family protein

Version

NM_001064840.2 GI:297606319 GeneID:4341778

Length

6075 bp

Definition

Oryza sativa Japonica Group Os06g0665800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:28394376..28400450

Sequence Coding Region

28394524..28395042

Expression

GEO Profiles:Os06g0665800

Genome Context

<gbrowseImage1> name=NC_008399:28394376..28400450 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:28394376..28400450 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>acacctcttcatatacatgtctgcgattttctgctcttgcaggttggcattgaggacgtgagagccgaagtcatgcctgccggaaaagccgacgtggtccgctctctccaaaaggacgggagcatcgtcgccatggtcggggacggcatcaacgactcccctgcgctggcagcggccgacgtcgggatggccataggcggcggcaccgacatcgccatcgaggccgcggactacgtgctggtgaggaacaacctggaggacgtcatcacggcgatcgacctgtccaggaagacgttcagccggatccggtggaactacttcttcgccatggcgtacaacgtggtcgccatcccggtcgccgccggcgcgctgttccccttcacgaggctgcagatgccgccgtggctcgccggcgcctgcatggcgttctcctccgtcagcgtggtgtgctcctcgctgttgttgagaaggtacaggaaaccaaggctgaccaccgtgttgcagataactgtagagtga</cdnaseq>

Protein Sequence

<aaseq>TPLHIHVCDFLLLQVGIEDVRAEVMPAGKADVVRSLQKDGSIVA MVGDGINDSPALAAADVGMAIGGGTDIAIEAADYVLVRNNLEDVITAIDLSRKTFSRI RWNYFFAMAYNVVAIPVAAGALFPFTRLQMPPWLAGACMAFSSVSVVCSSLLLRRYRK PRLTTVLQITVE</aaseq>

Gene Sequence

<dnaseqindica>5409..5927#ggctgctggactcgtacgacgaggagatggggggcggcgccgccgcggcggcggcgggggaggaggaggaggcgcacgtgcgggtcaccggaatgacgtgctcggcgtgcacgagcgccgtcgagggcgccgtctcggcccgccgcggcgtgcggcgcgtcgccgtgtccctgctccagaaccgcgcccacgtcgtcttcgacccggcgctcctcaaggtgatttccgcgcgattgcgattgcaattgtgatgtgatccttttgcgtggctgagcccgtttgtcgagccgagttttgcgcgtctccgggagcaaactgggattcgtgagctcgttgacgctcacgcggtggtaaattttttgaagttttttcttgcgctggaattattgcgtaggtgatggttggtgcggtagaacaggattctaggaagctggatcgcgctgcttgctcgtggtttttctcgagcggttagaagttggtgaatcggaatttactcttgtctaataataagttgagtttactaattactatgtgtgtgagtgtgagaccgagtcaatcgtgtatgatattgcaattttgggttttagctggagatgattttttttttctttttgacttcaccttgcgatgacgacttttcatgagttgattcgtgaaatgtggttagcccacagtgcccagaggccagagtttttgtgctccttttgctttggcggttggatgagctgtaaccttgttgcaagctcgtgattgtggctggactctctggattgtgggatttgggagctcaaaaaggctggcagtttgctgcgattggttgttgctaccggcagaaatggggtaactgctgtactacgataggtttgattggctggtgaggcagggagcagccgagtcatgttttcggggggaaagggtgctaagttaaggatcccaatttatgtggcttctaagtactcattgaagtttcctttgagcaaaattgaatgcaaaatgatgttacatgctaattttgggacaagcatataatctcattattctaggcccagtaattaccatgcaagtgtataaactttcagcagtgataaaatttagtcttatcatagtaataacagtgtacttcacaattgaaatttattaatgcttatggttattatgttgtgaagtactctacagtttctggttttaatgactgttaatgtgaatattagttgagttgtagcgctagcaactttttgatgagcctattgtagtgcagacggggaatgttgtgtttcatccttttgcttttgttggaactattaaggatggctttcctgactattaagtagacatttaccagcaagttctatctgctacctcctgttcataataggcattcatttagtttgtttttaatggccacctactattcattgttgacacacatttttagattatatgggtcaattagctacctgcaatttttatttgggtacttgtttatacaggttgaggatataatagaagctatagaagatgccggatttgacgcagaaattatcccagatactgctatctctcagccaaaggcacaaaagactctgtcagcacaatttagaataggaggaatgacatgtgctaattgtgtgaactcagttgaggggatcttgaaaaggctatctggtgtaaaaggagctgttgttgccttagcaacctcactaggggaagttgagtatgatccttctgtcattaacaaggatgaaattgttgaggctattgaggatgctggttttgaagctgcattcttacagagcagcgaacaagataagattttgctaggcctgactggattgcacacagagcgggatgttaatgtgttacatgatatcctcaagaagatgattggtttgcgacagtttgatgtaaatgctacggtctcagaagtagaaattatatttgatccggaagcagttggtctgagatcaattgtggatgcaattgagacaggaagcaatggaagattgaaagctcatgtgcagaatccatatgcacgaggggcttcaaatgacgcacatgaggccgccaaaatgcttcatcttctccgctcgagcttattcttaagtgtaagttttgacctttgctcttctttttcaccaccagcatagttatgcatttttgcacaaagatttttagttggatcaatgtttgtgacaatatccttgacatggttgtgacctggaggacccttctggacttctgttggagcattttagttatgtggaaaaacagcaatcatcatgtccctgtgccatttgaatcagttattttctcctaaccacataatagtttagattttttctatttactttcttctatcttacatgtgagatccacttgccataggaaagcatgctgctttaattctaggtttgggggtttgggctgttcataaaagataacaagcacattttacttcatacttgaattaaatttggcagtactgaacatttgggagtgttagatgatatgttccctagctacgtagttcttttgcttctttatatttcagaatacttttgaacttctcttctgcttgcttactaactctatccaactgtgtccttgcaccagattcctgtattttttatacgcatggtctgccctcatatacctttcattcgttcaatactaatgatgcactgtggaccatttcatatgggagatttgctgaagtggatattggtaagcattgtacagtttgttgtcggcaaacggttctacattgcggcttatagggccctgagacacggctctacaaatatggatgtgttagttgttcttggcaccactgcatcatatgtatactctgtttgtgcactcctatacggagcattcactgggtttcaccctcccatatattttgagacaagtgcaatgataattacatttgtgttgtttgggaagtatcttgaggtgcttgcaaaagggaaaacttctgatgctatcaagaagcttgtagaattggtccctgctactgctcttttgcttctgaaagacaaaggtatatggtaaaattttgtccttcaaaacatatacaattaagtcacagtgccacactcatcacattagttttagaagttatttctgacttgttttaggcaaccgcctgtgttttttttttcatttcatactatcaagttacacaaactcacattgttcttttcaaatgcagaaggaaaatatactgaggagagagaaattgatgcgctattagtccaacctggagacatcttaaaagtgcttcctggttcaaaggttcctgctgatggtgttgttgtgtggggaacaagccatgtcaatgaaagtatgataactggtgaatctgcaccaattcccaaagaagtatctagtgcagtaatcggagggacaatgaacttgcatggtgtccttcatatacaagcaaacaaagtaggatccgagacagttctgagtcagatcatatctctggttgaaactgctcagatgtccaaagcccccattcagaaatttgctgattatgtgagtaacctcccatattcttttctgtgatgtccttcatttgctttgtctgtacttattttaagtgtttaccgtgtactttacatattaactttaaaagcgtcagagcattttttgtgatctatttactatttccgatacttgagaatgttgcaggcaaatgttgtttgtttatgagaatttgattgttcatatgccctcttttaacatcatcattcttatgttgctttctacttctgatgtaaaaagttgtaacttgtttaatctcaaaacattttggctgcttaggagtaccttccagtccaaagtttttccctgtgttaactttagtctttgaccttctatgctttcttaatacaaacatacatgtcttttgtatattcgtgaaaaatttaacagaactcttggaagaatagactagtttcttttatctgtgaaaagctcttgtgtctcctaaatgtgcggtaatgattatagaggcctgttatggttaatgctgacactgcctacattttgctttcaggttgctagcatttttgttccaattgtcatcaccttgtccatgattacattccttgtatggtaagttcaacatatactaacacaatttttgagtgatactatgtttgaaacttcaatttttctgacatgtacattggctgcttttgtaggtttttatgtggatgggtgggagcatacccaaattcatggatttctggaactagcaactgctttgttttctctctcatgtttgcaatagctgtagttgtgattgcttgcccttgcgcccttggtctggcaacacctactgctgtgatggtggcaactggagttggagctaatcatggagtacttgtgaaggggggagatgcattagagagggctcaaaatgtaaattacgtgatttttgacaaaacaggcacactaacacaaggaaaagcagttgtgacaacagcgaaggttttctcaggaatggatcttggggatttcctcacattagtagcatctgcagaggtgaggttgaacttaagttgcttgtatggttcatatcaagctgtagtaaatgtgtttcggtattgtaactatgcttcatatgaatgtggtaatgccaaaatatgttttgctcctcagggttttagttaaaaaaaaagtgttttggtcttgttcatattgacttgtcaaaagtaaaaaaagttcttttgttttctactcaggcaagcagtgagcatcctctggcaaaagcaattgtggaatatgcattccatttccatttctttggcaagctccctacatcaaaagatggcattgaacaaagaaaagaagacagattatctcagttgctccttcaagttgaagacttctctgccttgcctggcaaaggagttcaatgcttgattaatgggaagagagttctggtgagtcacataagctaccataactcttccttgcccttcttgcagctgagttgaaaacagtgtacaagtctaacccatctactgctgtaccatttcttttaagcaaaccactgattatctagacataactgttttgcaggttggaaatcgtactttggttactgaaaatggtgtgaatgttcccccagaagctgaaaatttcttggtagacctggaactgaatgctaaaacaggcattcttgtgtcctatgacgatgattttgtgggtttaatggggataactgatcccctgaaaagagaggctgctgtagttgtggaaggactaaagaagatgggtgttcatcccgtgatgctcacaggtgacaactggagaaccgcaaaagccgttgcaaaggaggttagtctctaatctctattaccttccttgatccataatgttcatcatttacctgaacacctcttcatatacatgtctgcgattttctgctcttgcaggttggcattgaggacgtgagagccgaagtcatgcctgccggaaaagccgacgtggtccgctctctccaaaaggacgggagcatcgtcgccatggtcggggacggcatcaacgactcccctgcgctggcagcggccgacgtcgggatggccataggcggcggcaccgacatcgccatcgaggccgcggactacgtgctggtgaggaacaacctggaggacgtcatcacggcgatcgacctgtccaggaagacgttcagccggatccggtggaactacttcttcgccatggcgtacaacgtggtcgccatcccggtcgccgccggcgcgctgttccccttcacgaggctgcagatgccgccgtggctcgccggcgcctgcatggcgttctcctccgtcagcgtggtgtgctcctcgctgttgttgagaaggtacaggaaaccaaggctgaccaccgtgttgcagataactgtagagtgacattgacattgctcctgtatacgtacatagattccccctcttcaccgtttcatcacagaaatgaaatgagatgagaaaaggaaggccgatggcgtctcttgtaatttgtggatcgctctggacgctgtttgctttacaggttttttcg</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0665800, RefSeq:Os06g0665800

  1. 1.0 1.1 1.2 1.3 1.4 Sichul Lee, Yu-Young Kim, Youngsook Lee, and Gynheung An*. (2007) Rice P1B-Type Heavy-Metal ATPase, OsHMA9, Is a Metal Efflux Protein. Plant Physiology: 831–842.
  2. 2.0 2.1 Spielmeyer W, Ellis MH, Chandler PM (2002) Ryuichi Takahashi, Khurram Bashir, Yasuhiro Ishimaru, NaokoK.Nishizawa and Hiromi Nakanishi*. (2012) The role of heavy-metal ATPases, HMAs, in zinc and cadmium transport in rice. Plant Signaling & Behavior 7:12, 1605–1607.