Difference between revisions of "Os11g0508600"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Labs working on this gene)
Line 12: Line 12:
  
 
==Labs working on this gene==
 
==Labs working on this gene==
Please input related labs here.
+
a Department of Plant Pathology, Kansas State University, Manhattan, Kansas 66506
 +
b Department of Genetics, Development, and Cell Biology, Iowa State University, Ames, Iowa 50011
  
 
==References==
 
==References==

Revision as of 10:39, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Os-11N3 is represented in databases by a 1494-base full-length cDNA (National Center for Biotechnology Information accession number AK101913), has four introns, and a predicted coding frame of 909 bp (Figure 2B). BLAST analysis was performed with the predicted protein product of Os11N3 (Os-11N3), and 18 of the most similar proteins from monocotyledonous species and three sequences of the most similar proteins from representative dicotyledonous species were subjected to phylogenetic analysis(Figure 3). While closely related to Os-8N3, Os-11N3 is a member of a distinct clade of N3 proteins (clade II) that are separated from the Os-8N3 clade (clade I) prior to the divergence of dicots and monocots as some members from Arabidopsis thaliana (At5g23660), pepper (Capsicum annuum; CaUPA16), and soybean (Glycine max; GmABT17358) are more similar to Os-11N3 (Figure 3). Os-11N3 is more closely related to another clade represented by the rice N3 gene Os12g0476200. The separation of Os-11N3 from Os12g0476200 occurred prior to the divergence of rice, sorghum (Sorghum bicolor), and maize (Zea mays;Figure 3). The separation of Os-S11N3 from the other members within rice indicates a possible specialization of this protein in plant development or environmental responses.

Expression

Loss or Suppression ofOs-11N3 Expression Results in Loss of TAL Effector-Specific Susceptibility in Rice.The T-DNA insertion event PFG_3D-03008 was previously reported to have occurred within the first intron of Os-11N3 in rice cultivar Hwayoung (Jeong et al., 2006).The requirement for Os-11N3 in AvrXa7- and PthXo3-mediated virulence was also assessed by RNA-mediated gene silencing (RNAi). Transgenic rice plants were generated that expressed a unique 341-base portion of the 39-UTR of Os-11N3 as a small double-stranded RNA to initiate silencing of the full transcript.

Evolution

Variations in the TAL effector repetitive domains are driven by selection to overcome both dominant and recessive forms of resistance to bacterial blight in rice. The finding that Os-8N3 and Os-11N3 encode closely related proteins also provides evidence that N3 proteins have a specific function in facilitating bacterial blight disease.

Labs working on this gene

a Department of Plant Pathology, Kansas State University, Manhattan, Kansas 66506 b Department of Genetics, Development, and Cell Biology, Iowa State University, Ames, Iowa 50011

References

Please input cited references here.

Structured Information

Gene Name

Os11g0508600

Description

Similar to MtN3 protein precursor

Version

NM_001074487.2 GI:297611883 GeneID:4350572

Length

2772 bp

Definition

Oryza sativa Japonica Group Os11g0508600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:19998168..20000939

Sequence Coding Region

19998520..19998849,19999002..19999121,19999221..19999593,19999890..19999926,20000660..20000711

Expression

GEO Profiles:Os11g0508600

Genome Context

<gbrowseImage1> name=NC_008404:19998168..20000939 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:19998168..20000939 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctggcatgtctcttcagcatccctgggccttcgcctttggtctcctaggcaacatcatctccttcatgacctacctggccccactgccgacgttctacaggatctacaagagcaagtcgacgcaggggttccagtcggtaccctacgtggtggcgctgttcagcgcgatgctgtggatctactacgcgctgctcaagtccgacgagtgcctcctcatcaccatcaactccgctggctgcgtcatcgagaccatctacatcgccgtctacctcgtctacgcccccaagaaggccaagatgttcaccgccaagctcctcctcctcgtcaacgtcggcgtcttcggcctcatcctcctcctcaccctcctcctctccgccggcgaccgccgcatcgtggttcttggttgggtctgcgttggcttctccgtcagcgtcttcgtcgccccccttagcatcatcaggctggtggtgcgcaccaagagcgtggagttcatgccgttctcgctctccttctccctcaccatcagcgccgtcgtctggttcctctacggcctcctcatcaaggacaaatatgtcgctcttcccaacgtgctgggcttctccttcggcgtcatccagatggggctgtacgccatgtacaggaactcgacgcccaaggccgtgctgaccaaggaggtcgaggcggcgacggccaccggcgacgacgaccactccgccgccggcgtcaaggagcacgtcgtcaacatcgccaagctctctgccgccgtcgacgtcgtcaagacccgcgaggtgcaccccgtcgacgtcgagtccccgccggcagaggcgccgcctgaggaggacgacaaggccgccgccgccaccgccgccgccgtcgccggcgccggcgagaagaaggtagctgcatga</cdnaseq>

Protein Sequence

<aaseq>MAGMSLQHPWAFAFGLLGNIISFMTYLAPLPTFYRIYKSKSTQG FQSVPYVVALFSAMLWIYYALLKSDECLLITINSAGCVIETIYIAVYLVYAPKKAKMF TAKLLLLVNVGVFGLILLLTLLLSAGDRRIVVLGWVCVGFSVSVFVAPLSIIRLVVRT KSVEFMPFSLSFSLTISAVVWFLYGLLIKDKYVALPNVLGFSFGVIQMGLYAMYRNST PKAVLTKEVEAATATGDDDHSAAGVKEHVVNIAKLSAAVDVVKTREVHPVDVESPPAE APPEEDDKAAAATAAAVAGAGEKKVAA</aaseq>

Gene Sequence

<dnaseqindica>2091..2420#1819..1938#1347..1719#1014..1050#229..280#atcaagccttcaagcaaagcaaactcaagtagtagctgattaccagctcttctctcttctcattgagaagagggaattaagttttgatctctgctttattgcctgatcatcctcttgttacttgcaagcaagaacagtagtgtactgtgcctcattgatctcctcccaccaaactctctctctctctctcatattccgagctagctagttaatcaagatcttgctgcaatggctggcatgtctcttcagcatccctgggccttcgcctttggtctcctaggtgtgttgcctttgatctgatccaaggaattctcttgagaattaatcttgcatggttatttacttttgttgttattattctctacatttttaatcatgtacttttccatgttccacttttgttgccaaagctactatatttttcctaccaattcatccaaaactactatattatagcaaggcagctagtggatcgactttgcacttttggatgcaattgtgagtggtttacattagaggggccatgcatagccaaataaattgtttggcaaaatatgatttcccttgtagttagcacaatattgtgatctttcattcctttactctttttgttccaccaccctcattattgcaaagccccctcttttagaaccaaactaaagataagaaacatttgattcatcattagaggagattagatatacatacatactacacatgcattgctgtgataagcctagccaggcacagaaagagccaagacaaaaggagctcaaaagaaaaggggctccaatatcttgcccggcctgatcagtgtaacatgacgtcacccacacaattattaaaaggatagatgcatatgtgttcgttacgtatctccttgtgtcacgttgctgtgcatggttcactcgcttaattataacgtccgtcgcattttatgcatgcacttcgtttttagttaatcaaattaaacaagatcctaacatatgatttctattttattctctttgcaggcaacatcatctccttcatgacctacctggccccactgtaagtcccacacatccggatattttcttttctttagcgaaattttacattgctccagaaagtaccttttacactaaaatttcttatacaccaccataaaattaatgtggtactattggtaccttatcaaaaatgataaaattacctttttcttcagataaaaacactccccgtctctgtataactaagatgtagacaaccaatacacatgtctagagctaatcctatcaattaacattgctagtaaatacaaggaaaaatataaagaattaaccaattgcttggatgtcttgcaggccgacgttctacaggatctacaagagcaagtcgacgcaggggttccagtcggtaccctacgtggtggcgctgttcagcgcgatgctgtggatctactacgcgctgctcaagtccgacgagtgcctcctcatcaccatcaactccgctggctgcgtcatcgagaccatctacatcgccgtctacctcgtctacgcccccaagaaggccaagatgttcaccgccaagctcctcctcctcgtcaacgtcggcgtcttcggcctcatcctcctcctcaccctcctcctctccgccggcgaccgccgcatcgtggttcttggttgggtctgcgttggcttctccgtcagcgtcttcgtcgccccccttagcatcatcgtaagaaaccctagaattgcctgtaaacaataataactttcggtctctgcaccaactaaggatgcacatatttacgcaccgcttttgctatctctgcagaggctggtggtgcgcaccaagagcgtggagttcatgccgttctcgctctccttctccctcaccatcagcgccgtcgtctggttcctctacggcctcctcatcaaggacaaatatgtcgctgtgagtagctccgattcgacccgttcttcttcctaaattttccgctgctcgatttaatttctatttctaattgtggaagattgtttaattatagtgattatggctagctgataaccgattttaatttctgatggtgatccaaaatggaacagcttcccaacgtgctgggcttctccttcggcgtcatccagatggggctgtacgccatgtacaggaactcgacgcccaaggccgtgctgaccaaggaggtcgaggcggcgacggccaccggcgacgacgaccactccgccgccggcgtcaaggagcacgtcgtcaacatcgccaagctctctgccgccgtcgacgtcgtcaagacccgcgaggtgcaccccgtcgacgtcgagtccccgccggcagaggcgccgcctgaggaggacgacaaggccgccgccgccaccgccgccgccgtcgccggcgccggcgagaagaaggtagctgcatgagtgcgtgcatgcgtacatgggtcgccgtaagaaggaagaaggcgtgacgtgtccagcccgtacgcgcgccacgtggccaagctagcttcagagctagtgaagctgcagacatgctagctggctagctagcagtgagagagtgcgacgactaaaaaaaaagtagtgattaattaagggcttgtaatttaatcgttgttttttttttctctgtttcgttgagatcgatatcgttgtcaccatgcatgtatttcgtttttgattctcagtaattaattagatgggctttctgtaattcaacctgtaagggttccttccatgattaattaattagcgtgttaataattgtcccacc</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0508600, RefSeq:Os11g0508600