Difference between revisions of "Os09g0494200"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 6: Line 6:
 
The rice Os09g0494200 was reported as ''Brittle Culm15'' (''BC15'') which encodes a membrane-associated chitinase-like protein required for cellulose biosynthesis in rice. Plant chitinases, a class of glycosyl hydrolases, participate in various aspects of normal plant growth and development, including cell wall metabolism and disease resistance. ''BC15'' was designated as ''Chitinase-Like Protein1''(''OsCTL1'') and will henceforth be referred to as ''BC15/OsCTL1''.  
 
The rice Os09g0494200 was reported as ''Brittle Culm15'' (''BC15'') which encodes a membrane-associated chitinase-like protein required for cellulose biosynthesis in rice. Plant chitinases, a class of glycosyl hydrolases, participate in various aspects of normal plant growth and development, including cell wall metabolism and disease resistance. ''BC15'' was designated as ''Chitinase-Like Protein1''(''OsCTL1'') and will henceforth be referred to as ''BC15/OsCTL1''.  
 
----
 
----
BC15/OsCTL1 is an N-glycosylated membrane protein. Mutation of BC15/OsCTL1 causes reduced cellulose content and mechanical strength without obvious alterations in plant growth. Biochemical assays demonstrated that BC15/OsCTL1 is a Golgi-localized type II membrane protein that lacks classical chitinase activity. Investigation of the global expression profile of wild-type and ''bc15'' plants, using Illumina RNA sequencing, further suggested a possible mechanism by which BC15/OsCTL1 mediates cellulose biosynthesis and cell wall remodeling. And it is localized in the Golgi apparatus with its C-terminus facing the Golgi lumen. <ref name="ref1" />
+
BC15/OsCTL1 is an N-glycosylated membrane protein. Mutation of BC15/OsCTL1 causes reduced cellulose content and mechanical strength without obvious alterations in plant growth, showed in Figure 1. Biochemical assays demonstrated that BC15/OsCTL1 is a Golgi-localized type II membrane protein that lacks classical chitinase activity. Investigation of the global expression profile of wild-type and ''bc15'' plants, using Illumina RNA sequencing, further suggested a possible mechanism by which BC15/OsCTL1 mediates cellulose biosynthesis and cell wall remodeling. And it is localized in the Golgi apparatus with its C-terminus facing the Golgi lumen. <ref name="ref1" />
  
 
[[File:one.jpg]]
 
[[File:one.jpg]]

Revision as of 12:42, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The rice Os09g0494200 was reported as Brittle Culm15 (BC15) which encodes a membrane-associated chitinase-like protein required for cellulose biosynthesis in rice. Plant chitinases, a class of glycosyl hydrolases, participate in various aspects of normal plant growth and development, including cell wall metabolism and disease resistance. BC15 was designated as Chitinase-Like Protein1(OsCTL1) and will henceforth be referred to as BC15/OsCTL1.


BC15/OsCTL1 is an N-glycosylated membrane protein. Mutation of BC15/OsCTL1 causes reduced cellulose content and mechanical strength without obvious alterations in plant growth, showed in Figure 1. Biochemical assays demonstrated that BC15/OsCTL1 is a Golgi-localized type II membrane protein that lacks classical chitinase activity. Investigation of the global expression profile of wild-type and bc15 plants, using Illumina RNA sequencing, further suggested a possible mechanism by which BC15/OsCTL1 mediates cellulose biosynthesis and cell wall remodeling. And it is localized in the Golgi apparatus with its C-terminus facing the Golgi lumen. [1]

One.jpg

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os09g0494200

Description

Similar to Chitinase-like protein (EC 3.2.1.14)

Version

NM_001070084.1 GI:115479910 GeneID:4347451

Length

1807 bp

Definition

Oryza sativa Japonica Group Os09g0494200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:19801754..19803560

Sequence Coding Region

19802078..19802480,19802568..19802724,19802797..19803217

Expression

GEO Profiles:Os09g0494200

Genome Context

<gbrowseImage1> name=NC_008402:19801754..19803560 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:19801754..19803560 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagaggaagactcggaacaagataatcctgacgacgctgctggtgtcggcggcggcgatcctgatcggcgggacggtggcgctgatcctgacggcggggacatggaaggtgaagatgaaggagtcgcgcgagaagatctgcgacaaggggtgggagtgctcgggtagcaagtactgctgcaacgacaccatcaccgacttcttcaaggtgtaccagttcgagaacctcttctccaagcgcaacagccccgtcgcccacgccgtcggcttctgggactaccagtccttcatcaccgccgccgccctcttcgagcccctcggcttctgcaccaccggcggcaagcagatgcagatgatggagctctgcgccttcctcggccatgtcggctccaagacctcatgtggatttggtgtggcgaccggcgggccgacggcgtgggggctctgctacaaccacgagatgagccctaaggaggattactgcgacaagacgaacctgcagtatccctgcgtcgagggcgccgagtactacggccgcggcgccatccccgtcttctggaactacaactatggcgcggcgggcgacgggatacacgaggacctgctccaccacccggagtacctggagcagaacgcgacgatggcgttcatggcggcgatgtggcggtggatgacgccgatgaagaagaagcagccgtcggcgcacgacgtgttcgtgggcaactggaagcccaccaagaacgacacgctcgccaagcgcctccccgggttcggcgccaccatgaacgtgctctacggcgaccagatctgcggcaagggctacatcgacgacatgaacgtcatcatctcgcactaccagtactacctcgacctcatgggcgtcggccgcgagcactccggcgacaaccgcgactgcgccgagcaggccgccttcaacccctcctacaagaagcccgacgatcagcagcaacaaagctag</cdnaseq>

Protein Sequence

<aaseq>MKRKTRNKIILTTLLVSAAAILIGGTVALILTAGTWKVKMKESR EKICDKGWECSGSKYCCNDTITDFFKVYQFENLFSKRNSPVAHAVGFWDYQSFITAAA LFEPLGFCTTGGKQMQMMELCAFLGHVGSKTSCGFGVATGGPTAWGLCYNHEMSPKED YCDKTNLQYPCVEGAEYYGRGAIPVFWNYNYGAAGDGIHEDLLHHPEYLEQNATMAFM AAMWRWMTPMKKKQPSAHDVFVGNWKPTKNDTLAKRLPGFGATMNVLYGDQICGKGYI DDMNVIISHYQYYLDLMGVGREHSGDNRDCAEQAAFNPSYKKPDDQQQQS</aaseq>

Gene Sequence

<dnaseqindica>325..727#815..971#1044..1464#acacacaacggcaacgtcttaccagctcggagctctctcgcttgctgcctcttctcttcttcctcccgccaccgacaccacctccaccagcagcttcgccttcgccgcgtcggcatctgcagttgccacttcgctttcttccactccctcctcctcctcgcttacctcacactcctcccccccaatttcatcccccacccaccaccagatcccccaccacctgccgcattctcccccccaagatccagatcgccggtcacccccacgaactcgctcgagatccagagagagagagagaggcagtttcttggttgattttcgaggatgaagaggaagactcggaacaagataatcctgacgacgctgctggtgtcggcggcggcgatcctgatcggcgggacggtggcgctgatcctgacggcggggacatggaaggtgaagatgaaggagtcgcgcgagaagatctgcgacaaggggtgggagtgctcgggtagcaagtactgctgcaacgacaccatcaccgacttcttcaaggtgtaccagttcgagaacctcttctccaagcgcaacagccccgtcgcccacgccgtcggcttctgggactaccagtccttcatcaccgccgccgccctcttcgagcccctcggcttctgcaccaccggcggcaagcagatgcagatgatggagctctgcgccttcctcggccatgtcggctccaagacctcatgtgtgtagcttcttcgttttcgctatggtttgatttggatttgaggttttaagctcgccattgatggggatttgtgtgtgtgtgcaggtggatttggtgtggcgaccggcgggccgacggcgtgggggctctgctacaaccacgagatgagccctaaggaggattactgcgacaagacgaacctgcagtatccctgcgtcgagggcgccgagtactacggccgcggcgccatccccgtcttctggtaagcttcgcttcgtcgccgccatctcgatcgcttgatttgatgattgattcggattcggattcggaataggaactacaactatggcgcggcgggcgacgggatacacgaggacctgctccaccacccggagtacctggagcagaacgcgacgatggcgttcatggcggcgatgtggcggtggatgacgccgatgaagaagaagcagccgtcggcgcacgacgtgttcgtgggcaactggaagcccaccaagaacgacacgctcgccaagcgcctccccgggttcggcgccaccatgaacgtgctctacggcgaccagatctgcggcaagggctacatcgacgacatgaacgtcatcatctcgcactaccagtactacctcgacctcatgggcgtcggccgcgagcactccggcgacaaccgcgactgcgccgagcaggccgccttcaacccctcctacaagaagcccgacgatcagcagcaacaaagctagaacagatcacccccaattccccccaattccacggtaaagaattcacccaatgtgttgttgtatacatcttcttgctactgcaatcgctattgccaatgcaaaccaaccattgccattgctgttgcctcgtgagctatacagattaacggattcttcatcagtgtgaggagctgtggtttgcattggtgtatttctgagtagcggattttgagggaagtgtcaactgtgtgtgtgatgcctatgggatttgggaaatttgttgtagcccttgttgtaccatagtgtacattttcattccatttgatttttgtcacatatacatgtttaaagaggaggattcagg</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0494200, RefSeq:Os09g0494200

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1