Difference between revisions of "Os02g0738900"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Expression)
Line 6: Line 6:
 
The expression pattern of the OsDRP2B gene in the tissues was analyzed by reporter gene assay using a Promoter OsDRP2B::β-glucuronidase (GUS) construct with 1,721 bp of upstream region of OsDRP2B. This construct was introduced into the wild-type cultivar Taichung 65. As the brittle phenotype was most obvious in the mature culms, we analyzed the GUS expression in three parts of the uppermost internode possessing a Xowering panicle (Fig. 1a). At the bottom of the internode adjacent to the node (the growing point where the culm is still young and soft), staining was conWned to the protoxylem tissue (Fig. 1b). Then, at the tissue 1–2 cm above the node, substantial and most active staining was seen in the developing cortical Wber cells, mainly adjacent to the developing cortical and small vascular bundles, and staining of the protoxylem tissue was weaker than the cortical Wber cells (Fig. 1c). At the top of the internode where the sclerenchyma was apparent, staining as seen only in the inner parts of the cortical Wber tissue that is seemingly at the completion stage of development (Fig. 1d). These expression patterns seem to correlate with the development of secondary walls of the cortical and vascular sclerenchymal Wber cells. As decreases in the cellulose fraction were also seen in the leaves, roots, and young seedlings of bc3 mutants, the expression of OsDRP2B promoter-GUS was also examined in these tissues (Fig. 2). Relatively strong GUS activity was observed mainly in the young tissues with active cell expansion. In leaves, at the youngest stage, GUS staining was observed in parenchymal tissue (Fig. 9a), and then shifted to the tracheal and phloem primordia in the young vascular bundles (Fig. 2b, c), but could not be detected at later stages. In roots, staining was observed at the very young stele (Fig. 2d) and at the bases of developing lateral roots (Fig. 2e). In mature anthers, GUS staining was also observed at the cortical layer and most strongly at the inner layer, which was considered to be the tapetum (Fig. 2f).
 
The expression pattern of the OsDRP2B gene in the tissues was analyzed by reporter gene assay using a Promoter OsDRP2B::β-glucuronidase (GUS) construct with 1,721 bp of upstream region of OsDRP2B. This construct was introduced into the wild-type cultivar Taichung 65. As the brittle phenotype was most obvious in the mature culms, we analyzed the GUS expression in three parts of the uppermost internode possessing a Xowering panicle (Fig. 1a). At the bottom of the internode adjacent to the node (the growing point where the culm is still young and soft), staining was conWned to the protoxylem tissue (Fig. 1b). Then, at the tissue 1–2 cm above the node, substantial and most active staining was seen in the developing cortical Wber cells, mainly adjacent to the developing cortical and small vascular bundles, and staining of the protoxylem tissue was weaker than the cortical Wber cells (Fig. 1c). At the top of the internode where the sclerenchyma was apparent, staining as seen only in the inner parts of the cortical Wber tissue that is seemingly at the completion stage of development (Fig. 1d). These expression patterns seem to correlate with the development of secondary walls of the cortical and vascular sclerenchymal Wber cells. As decreases in the cellulose fraction were also seen in the leaves, roots, and young seedlings of bc3 mutants, the expression of OsDRP2B promoter-GUS was also examined in these tissues (Fig. 2). Relatively strong GUS activity was observed mainly in the young tissues with active cell expansion. In leaves, at the youngest stage, GUS staining was observed in parenchymal tissue (Fig. 9a), and then shifted to the tracheal and phloem primordia in the young vascular bundles (Fig. 2b, c), but could not be detected at later stages. In roots, staining was observed at the very young stele (Fig. 2d) and at the bases of developing lateral roots (Fig. 2e). In mature anthers, GUS staining was also observed at the cortical layer and most strongly at the inner layer, which was considered to be the tapetum (Fig. 2f).
 
[[File:图片3.jpg]]
 
[[File:图片3.jpg]]
 +
 
Figure.1 Developmental changes in the expression pattern of OsDRP2B promoter-GUS in the culm. '''a''' Scheme of the sectioned loci in a culm. '''b–d''' GUS staining of transverse sections of culms at the loci indicated in '''a. b''' GUS activity in the soft immature tissue near the basal developing point where cells are still lacking the developed sclerenchyma. '''c''' GUS activity in the slightly upper culm region compared to '''a. d''' GUS activity in the hard mature tissue. px protoxylem, cf cortical Wber cells.Bars 100 μm
 
Figure.1 Developmental changes in the expression pattern of OsDRP2B promoter-GUS in the culm. '''a''' Scheme of the sectioned loci in a culm. '''b–d''' GUS staining of transverse sections of culms at the loci indicated in '''a. b''' GUS activity in the soft immature tissue near the basal developing point where cells are still lacking the developed sclerenchyma. '''c''' GUS activity in the slightly upper culm region compared to '''a. d''' GUS activity in the hard mature tissue. px protoxylem, cf cortical Wber cells.Bars 100 μm
  
 
[[File:图片2.jpg]]
 
[[File:图片2.jpg]]
Figure.2 Expression patterns of OsDRP2B in various rice tissues. '''a–c''' Transverse sections of leaves. '''a''' In the very young leaves. '''b''' In mature leaf tissues. Arrowheads show primordia of tracheae and phloem. c Higher magnification (×20) of the area circled in '''b. d''' Young roots. '''e''' Developing lateral roots. '''f''' Mature anther. tp tracheae primordium, pp phloem primordium. Bars 200 μm in a, 500 μm in '''b, d, e,''' and 100 �M in '''f'''
+
 
 +
Figure.2 Expression patterns of OsDRP2B in various rice tissues. '''a–c''' Transverse sections of leaves. '''a''' In the very young leaves. '''b''' In mature leaf tissues. Arrowheads show primordia of tracheae and phloem. c Higher magnification (×20) of the area circled in '''b. d''' Young roots. '''e''' Developing lateral roots. '''f''' Mature anther. tp tracheae primordium, pp phloem primordium. Bars 200 μm in a, 500 μm in '''b, d, e,''' and 100 μm in '''f'''
 +
 
 
===Evolution===
 
===Evolution===
 
Please input evolution information here.
 
Please input evolution information here.

Revision as of 13:19, 3 June 2014

Please input one-sentence summary here.

Annotated Information

Rice bc3 is one of the classical rice brittle culm mutants (Tanaka 1967), and has been used as a phenotype marker in rice genetic maps for breeding (Iwata and Omura 1977).

Expression

The expression pattern of the OsDRP2B gene in the tissues was analyzed by reporter gene assay using a Promoter OsDRP2B::β-glucuronidase (GUS) construct with 1,721 bp of upstream region of OsDRP2B. This construct was introduced into the wild-type cultivar Taichung 65. As the brittle phenotype was most obvious in the mature culms, we analyzed the GUS expression in three parts of the uppermost internode possessing a Xowering panicle (Fig. 1a). At the bottom of the internode adjacent to the node (the growing point where the culm is still young and soft), staining was conWned to the protoxylem tissue (Fig. 1b). Then, at the tissue 1–2 cm above the node, substantial and most active staining was seen in the developing cortical Wber cells, mainly adjacent to the developing cortical and small vascular bundles, and staining of the protoxylem tissue was weaker than the cortical Wber cells (Fig. 1c). At the top of the internode where the sclerenchyma was apparent, staining as seen only in the inner parts of the cortical Wber tissue that is seemingly at the completion stage of development (Fig. 1d). These expression patterns seem to correlate with the development of secondary walls of the cortical and vascular sclerenchymal Wber cells. As decreases in the cellulose fraction were also seen in the leaves, roots, and young seedlings of bc3 mutants, the expression of OsDRP2B promoter-GUS was also examined in these tissues (Fig. 2). Relatively strong GUS activity was observed mainly in the young tissues with active cell expansion. In leaves, at the youngest stage, GUS staining was observed in parenchymal tissue (Fig. 9a), and then shifted to the tracheal and phloem primordia in the young vascular bundles (Fig. 2b, c), but could not be detected at later stages. In roots, staining was observed at the very young stele (Fig. 2d) and at the bases of developing lateral roots (Fig. 2e). In mature anthers, GUS staining was also observed at the cortical layer and most strongly at the inner layer, which was considered to be the tapetum (Fig. 2f). 图片3.jpg

Figure.1 Developmental changes in the expression pattern of OsDRP2B promoter-GUS in the culm. a Scheme of the sectioned loci in a culm. b–d GUS staining of transverse sections of culms at the loci indicated in a. b GUS activity in the soft immature tissue near the basal developing point where cells are still lacking the developed sclerenchyma. c GUS activity in the slightly upper culm region compared to a. d GUS activity in the hard mature tissue. px protoxylem, cf cortical Wber cells.Bars 100 μm

图片2.jpg

Figure.2 Expression patterns of OsDRP2B in various rice tissues. a–c Transverse sections of leaves. a In the very young leaves. b In mature leaf tissues. Arrowheads show primordia of tracheae and phloem. c Higher magnification (×20) of the area circled in b. d Young roots. e Developing lateral roots. f Mature anther. tp tracheae primordium, pp phloem primordium. Bars 200 μm in a, 500 μm in b, d, e, and 100 μm in f

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0738900

Description

Similar to Dynamin 2B (EC 3.6.5.5) (Dynamin-related protein 2B) (Dynamin-like protein 3)

Version

NM_001054599.1 GI:115448568 GeneID:4330669

Length

9497 bp

Definition

Oryza sativa Japonica Group Os02g0738900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:31748536..31758032

Sequence Coding Region

31748895..31749121,31750320..31750492,31751055..31751122,31751228..31751341,31751649..31751806
,31751884..31752022,31752219..31752275,31752432..31752508,31752692..31752830
,31752958..31753036,31753415..31753542,31753637..31753720,31754440..31754559
,31754642..31754743,31754838..31754985,31755772..31756117,31756219..31756336
,31756677..31756738,31757211..31757315,31757417..31757537,31757637..31757687
,31757795..31757950

Expression

GEO Profiles:Os02g0738900

Genome Context

<gbrowseImage1> name=NC_008395:31748536..31758032 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:31748536..31758032 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcgtcgtcggccatggaggccatggacgagctcgtccagctcgccgagtccatgcgccaggccgcctccctcctggccgacgacgacccctccgacgaggccagcccgcgccgcccctccaccttcctcaacgccgtcgcgctcggcaacgtcggcgccggcaagtcggccgtgctcaacagcctcatcggccaccccgtgctgccgacgggtgagaacggggcgacgcgggcgccgatagtggtcgacctgcagagggatccggggctgagcagcaaatccatcgtcctgcagatcgacagcaagtcgcagcaggtgtcggcaagtgctctccgccattcgctgcaggacaggctgagcaagggggcgtccggtggatcagggaaaggccgaaacgatgagatttacctcaagctgcggacaagtacagctcctccaataaaattggtcgatttgcctggcatagaccaacgagttatggatgattcaactatcagtgaatatgctggacataatgatgcaatattgattgttgtgataccagcaatgcaagctgctgatgttgcatcatctcgagctctcagactagcgaaggatattgatccagatggaaccagaacaataggtgttttaagtaaaattgatcaagcatctgcagatgcaaaaactgtatcttgtgttcaggctatcttgtctaacaagggtgcaccacgagcagcagctgaaattgagtgggttgctctaatagggcaatctgtctcaattgcatcggcccaagctggatcagttggttctgagaactcactggaaactgcctggcaggctgaagcggagacactcaaatccatcctaactggagctcctcgaagtaagctagggagaattgctctcgtggataccattgctaagcagatacgtaaaaggatgaaaattcggctacctaaccttttgtccgggcttcaggggaagtctcagatagtgcaaaatgaacttgcaaggttgggagaacagatggtatcaagcgctgaaggaaccagggctgttgctttggagctttgccgtgaattcgaagacaagtttcttgcccatgttacttctggtgaggggtctggttggaaaattgttgcaagctttgaggggaagtttccagataggatcaaacagcttcctttggacaggcattttgatattaacaatgtcaaaaggattgtcctggaagccgatggttatcaaccatatttgatatctccagagaaaggtttaaaatccttaataaaaggagtacttgaaatggcaaaggagccatcacggctgtgtgttgaagaggtacaccgtgtattattggacatagtaaatgcttctgcaaatgctacaccaggacttggaagatatcctccattcaaacgcgaggtcgttgaaattgcaaccaatgcattggatgtcttcaaaagtgatgcaaaaaagatggtagttgcacttgttgatatggagcgtgcctttgtcccaccacaacacttcatccgtttagtacaaagaagaatggaaaggcaacgtcgtgaggatgaggtgaaaaacaggtcatctaagaaagcccaagatgcagaacagtccaacaagggctcaggcacaggatctgagcaatctggtggtgccttgaaatcgttgaaagaaaaattcagtcagcaagacaaagataaagatgcaaaagagggaccaaatttgcaggttgctgggcctggtggtgaaataactgcaggctaccttttgaagaaaagtgcaaaaaataatgaatggagcaaaagatggtttgtcctaaatgagaagagtggaaagcttgggtacaccaagaaacaagaggagagacattttcgaggtgttattgtcctggaggaatgtaatctggaagagatagaagaggaagagctttccaagagtttgaaggattcaaagaaggccaatggggcagagaaaggcccaagtcttgtatttaagattactaacagagttgcctacaaaactgtgctgaaatctcatagtgctgttatactgaaggccgagactattgctgacaaggttgaatggatgaagaagataagaggtgtcattcaaagcaaagggggttctgtgaagggtttaaatactcctgagggtggttccatgaggcaaagccattctgatgggtcccttgatacgatggcccggaagcctgctgatcctgaagaagaacttcggtggatgtctcaagaagttcgtggttatgtagaggctgttttgaacagtttggcagcaaatgttccaaaggcaatcgtactttgccaagtggagaaagcaaaggaagatatgctaaatcagctctacagcaaaataagtgctcaaaccaatgcaaagattgaagaacttctccaagaggaccacaatgctaaacgtagacgggagaagtaccaaaaacaatcatctctattgtcaaagcttactcgtcagcttagtatccatgacaatagagcttctgttgcatcgtataccaatgatagttctggagctgagagtagcccacggacctctggccagtcaggtgaggactggaggtctgcgttcgattctgcatcaaatggctctgttgatcgatccagttcacacaatgaaacaaggtcaagaagtgctgacagccgtggcaaacgctatgaaaatggggacgtgaatggtggtaactctggcagccgacgcacaccaaaccgtttgccaccagcacctccagggcaaaaatattaa</cdnaseq>

Protein Sequence

<aaseq>MSSSAMEAMDELVQLAESMRQAASLLADDDPSDEASPRRPSTFL NAVALGNVGAGKSAVLNSLIGHPVLPTGENGATRAPIVVDLQRDPGLSSKSIVLQIDS KSQQVSASALRHSLQDRLSKGASGGSGKGRNDEIYLKLRTSTAPPIKLVDLPGIDQRV MDDSTISEYAGHNDAILIVVIPAMQAADVASSRALRLAKDIDPDGTRTIGVLSKIDQA SADAKTVSCVQAILSNKGAPRAAAEIEWVALIGQSVSIASAQAGSVGSENSLETAWQA EAETLKSILTGAPRSKLGRIALVDTIAKQIRKRMKIRLPNLLSGLQGKSQIVQNELAR LGEQMVSSAEGTRAVALELCREFEDKFLAHVTSGEGSGWKIVASFEGKFPDRIKQLPL DRHFDINNVKRIVLEADGYQPYLISPEKGLKSLIKGVLEMAKEPSRLCVEEVHRVLLD IVNASANATPGLGRYPPFKREVVEIATNALDVFKSDAKKMVVALVDMERAFVPPQHFI RLVQRRMERQRREDEVKNRSSKKAQDAEQSNKGSGTGSEQSGGALKSLKEKFSQQDKD KDAKEGPNLQVAGPGGEITAGYLLKKSAKNNEWSKRWFVLNEKSGKLGYTKKQEERHF RGVIVLEECNLEEIEEEELSKSLKDSKKANGAEKGPSLVFKITNRVAYKTVLKSHSAV ILKAETIADKVEWMKKIRGVIQSKGGSVKGLNTPEGGSMRQSHSDGSLDTMARKPADP EEELRWMSQEVRGYVEAVLNSLAANVPKAIVLCQVEKAKEDMLNQLYSKISAQTNAKI EELLQEDHNAKRRREKYQKQSSLLSKLTRQLSIHDNRASVASYTNDSSGAESSPRTSG QSGEDWRSAFDSASNGSVDRSSSHNETRSRSADSRGKRYENGDVNGGNSGSRRTPNRL PPAPPGQKY</aaseq>

Gene Sequence

<dnaseqindica>8912..9138#7541..7713#6911..6978#6692..6805#6227..6384#6011..6149#5758..5814#5525..5601#5203..5341#4997..5075#4491..4618#4313..4396#3474..3593#3290..3391#3048..3195#1916..2261#1697..1814#1295..1356#718..822#496..616#346..396#83..238#caaccacatcacatcacaccagacgccaccacgccccccgagatctctcccacccccgaccagcctcgagatcccagcgcccatgtcgtcgtcggccatggaggccatggacgagctcgtccagctcgccgagtccatgcgccaggccgcctccctcctggccgacgacgacccctccgacgaggccagcccgcgccgcccctccaccttcctcaacgccgtcgcgctcggcaacgtcgtaagtgttttgcttccaccggagccgccgccgccgccgcccgcggcagctccccctctctcctccgcccgatctgactcgatccggcttgttgttgttccgtgcagggcgccggcaagtcggccgtgctcaacagcctcatcggccaccccgtgctggtgagtgtgcttcgggtttagctcgcttctctctcttctgcttttgtggcattcggtttttgtgaagctttgggtggtggttgctgtgtggtgatgcagccgacgggtgagaacggggcgacgcgggcgccgatagtggtcgacctgcagagggatccggggctgagcagcaaatccatcgtcctgcagatcgacagcaagtcgcagcaggtgtcggcaagtgagtgagatcttcccttggctagctggatctggcaatgggcgccggctggttggtgtgctgagtttggtggccctttctggtggcgttgtggcgtgcaggtgctctccgccattcgctgcaggacaggctgagcaagggggcgtccggtggatcagggaaaggccgaaacgatgagatttacctcaagctgcggacaagtacaggtttgttgctgggcttcacttttactcttacattgcacaatgttggtaagccagatgtatagtgagcatgtgccatgtgctgagtcgtgctaatgtttgcgccactgcccatactgcccctgtaattgtcggacattgatgccttgtgtattttatgtgttatagaaagctgaaatggtaagacaataagtggttgtagaaaaacggtatcaagagtgtcttctgatacagttgttagaatgtgctctcaggtttttgcaacactacaacgattgagtaccatacttagaataagcacaattttggatattgtactgctacatgtacaataatttcttctgtttgcttccctttgtttatattggtaatttttagatgatggaaatggtttacatctctggccttggccgttaggctcacaagtttatattggtaatgaattctcacttcagcatcttttgtttttttccagctcctccaataaaattggtcgatttgcctggcatagaccaacgagttatggatgattcaactgtgagtatttgcagtttcttgctcaattacacaacgatgattgaaccgcatgtagaataatccagactcctcataattaacatatgaatgtgtttatgaattggataaacttattatctaatcaatgtattggtggaaaatattccctttagaaaaggttggaagcatcatagtaatgacattgtgcatgcactttgactgagaagcattgaatgccctccatggatatattagttgcttgcacttattacataaaagagcacgaatatcttaagtatctgaaccatgtttgttgcatcttctcacaagtgttggatattgacttttctccacatttcagatcagtgaatatgctggacataatgatgcaatattgattgttgtgataccagcaatgcaagctgctgatgttgcatcatctcgagctctcagactagcgaaggatattgatccagatggtctgttataaaattcttataatcctgcccaataggcaattcataccattctctccgtagcaagtagaaactgatgtttatccttgttcatcttgttgtaggaaccagaacaataggtgttttaagtaaaattgatcaagcatctgcagatgcaaaaactgtatcttgtgttcaggctatcttgtctaacaagggtgcaccacgagcagcagctgaaattgagtgggttgctctaatagggcaatctgtctcaattgcatcggcccaagctggatcagttggttctgagaactcactggaaactgcctggcaggctgaagcggagacactcaaatccatcctaactggagctcctcgaagtaagctagggagaattgctctcgtggataccattgctaagcagatacgtaaaaggatgaaaattcggctacctaaccttttgtccgggtaagtgcattgcccttttttattatttttattttcctaaataattgaactttattttatttttaaagtaaactaagcacaaccccaacttttaagaaaactgaaacttagatggtcttggaatttggatgtcaaaacatctttcacatggaatttggatgtcaaaacatctttcacatttcatttcactaagatttcccttctacagtatcgttgtagttaaaagtaaacaatatgcatgtagcacaaattgtccaggttctatgtcgcaatcatatttcatgtatctagatatcccctccgcagtaccattattggagcttgtaccttctcttgtgtttatgcacctgtggaatcaagttgtttttttgtcagcacttccaagctccaatttcctatttgacctagcttggtacatttagatgatgtcaaacatggttatctactcatttcttctgaacttctgtgcatttggccaatctttttgcatctgcaactacatacttacaacacacatgcgtccatgacaagagaaatgccaagtataaaagatgtgtgaacagtttctacttggctacaaaatgtcaagcttaaactaccttttaaactccaaatttaaatttatgtagttcatgaacttttccgcggcataaatgacccttatttgatctatcaatgtaatgttatcatcacacaatggatcatggacactctggccttctgtaaaataagttgattttaatttcttgttaaattgctgatatatgtaccttgctacaattgcaggcttcaggggaagtctcagatagtgcaaaatgaacttgcaaggttgggagaacagatggtatcaagcgctgaaggaaccagggctgttgctttggagctttgccgtgaattcgaagacaagtttcttgcccatgttacttctggtgaggttagtgataagctcaagtatggtctttatatataccttaattagtatgtgccaaatgaaatacctgattacaaggctgttattcaatcaaaaggggtctggttggaaaattgttgcaagctttgaggggaagtttccagataggatcaaacagcttcctttggacaggcattttgatattaacaatgtcaaaagggtaaattcaaaagcccttctagaattaattttagagtgggcacactttgcttatgatgattactgttatctttatattctagattgtcctggaagccgatggttatcaaccatatttgatatctccagagaaaggtttaaaatccttaataaaaggagtacttgaaatggcaaaggagccatcacggctgtgtgttgaagaggtatgtcttttttgatcccctatatgtataatttactaactcacttaaaaaggtaaaatatgaatagttgagatgcaatttcatttttaccctttggatgaatgtcagaagtggattttggtggctatatttatcctgctaattttaaactttgtaacttccaatgaagtttatgatgcattaattaatcattttgttactgtgcatgggtaggcacttgccagcatagttattaagaccagatcgatgattgaacatctgatgggctcggttcagtggtttactggtctaaccggttagatcgccgctttgatccggtttaaatagacatatgctgcactataatcacaacagctgtcatagcccaacggtggagtatttttggtgttgtagcttggtcacgggttcgaatcccagtcttcacccttttttccctcaatttttgtgttactcgcatgcatggctgacgagtccactccacttgacaggcccacgtgggcagtcaccggtttatagccgacccaaaagatagagaaccgttcagtttgatcaggtgtttaccggtccgattgcgcactggtcttttaatcgaaccaggccgctaagagtgttggttccggtttattccgggtgaaccgccggtccggtctgcttctaataactatgcttgccagtgtagtgtcaatatgtaaactaaatacattttgtcaatatactaggtacaccgtgtattattggacatagtaaatgcttctgcaaatgctacaccaggacttggaagatatcctccattcaaacgcgaggtaccactttgttctatttcaccaacttacaatgcattctacttccctttcacctgcttcctgagcacaacatcccatcatctcttttctgaaggtcgttgaaattgcaaccaatgcattggatgtcttcaaaagtgatgcaaaaaagatggtagttgcacttgttgatatggagcgtgcctttgtcccaccacaacacttcatccgtttagtacaaagaaggtatgtcaggctcttaattgaataactttacagttggtttggtttcaatctgctctaatgtaacttcagtaaataatttccaccacaaaagctgatagggaagaataacattgacttgtagtcttatagaaatagcatcaactgcctaaatccaaatggaaaaaaggccggcatattttctgtacagagtgatgtgcccacgaagtataccacttcattacaacttctttgttagagaaatatagtttcatcccttagttgaagtggataatgtttccatactagtgtctgtctatgagctgaaagacctttacgatgttttcatgatttataatagcattgttcaatccttatatttggtttgatatgacattgcagaatggaaaggcaacgtcgtgaggatgaggtgaaaaacaggtcatctaagaaagcccaagatgcagaacagtccaacaaggtatgatttctgcctcttgcaccttgcacaaatgtgcttactgaaaggtcatgctaaaagtaatgactgcaagattcctttttcttgcgtttgtttggccctgaacattggttgccttctgtattagggctcaggcacaggatctgagcaatctggtggtgccttgaaatcgttgaaagaaaaattcagtcagcaagacaaagataaagatgcaaaagagggaccaaatttgcaggttgctgggcctggtggtgaaataactgcaggtataatgatgcgctgatgcaccataggttatcattcctgtagtttttttttatttactctggctcttcacagctagtgtaatctttcatttgtagttacaagtaactgcagatggttttggttaattctgtatcctggtttggcttttttgcatataagatgatttcttcttttctactcaggctaccttttgaagaaaagtgcaaaaaataatgaatggagcaaaagatggtttgtcctaaatgagaagagtggaaaggttaatatatctcgtacactgatgtactggtgttccccatatttgatttttctgaataataacttatgataatcttgtcatttgctgccgattttcaaatgtcctttatttagttaagaatttggtgtcatttactgttttttttttcatgtccagcttgggtacaccaagaaacaagaggagagacattttcgaggtgttattgtcctggaggtgtgcacttaactttttatacttctgtgttcatgctcaacagtgatctacgatactttagtttacaccttagacttgtaattttacagtccttgtggttccagttcacattcgatgattcaaactaaaaaagttgtgtgcacaactatgagagatgagatatgaacttaataacacaatttgctgcgtgagtcaggaatgtaatctggaagagatagaagaggaagagctttccaagagtttgaaggattcaaagaaggccaatggggcagagaaaggcccaagtcttgtatttaagattactaacagagttgcctacaaaactgtgctgaaatgttagtgtctctaaacgttatatgctgaggttttaaatgctaattatgttgcttaaagtgtgaatttcatgttgcagctcatagtgctgttatactgaaggccgagactattgctgacaaggttgaatggatgaagaagataagaggtgtcattcaaagcaaagggggttctgtgaagggtttaaatactcctgagggtggttccatgaggcaaagccattctgatgggtcccttgtatgttccttatttgacattttttatgctattgtcattgtaaagcttttaacatctacaattctgagttattgcctaagctatttttaccctctcttcagtggatgcttgtggcaagttttctactttaccagtgaccatgtttatcatttgaatttctctaagaaattaaagccacttgttttgtgcaactatcttaactgaacactcatatcaacctgttccactttcccacggccatgattattttttgaatgtgtcaaacacaaattttgaattgcctgtgacacaattactctcccttaaggatacgatggcccggaagcctgctgatcctgaagaagaacttcggtggatgtctcaagaagttcgtggttatgtagaggctgttttgaacagtttggcagcaaatgttccaaaggtttacatttgaacctcacaattgtttcaacagtcatactattttttaaactcaatttaacatggtcatagttgcaattgttattattgtctttttcatgatcaggcaatcgtactttgccaagtggagaaagcaaaggaagatatgctaaatcagctctacagcaaaataaggtttgatgcgtattctttctttgtatttgtgcattgcataaggtttcgcttctttctttttctccactaaatggacatacccctagatggaactgcattgaccttaagtatagatattgtctttttttttttccttttcaactcagttttctcttgttaacacgccactgttaacacttggatcagttgttaacaagtgaaaactgccaacacaaagactttggtgagcacctgcagatatttcactaaatggatatacccttagttttcctttttcaacttaaaggacttactgcaatgtctgcaggcgctactgaacattgttcgcataactcatattttatttattatttttatttctattcatgacattccttcacatggcatatcacaagtagatacatgacatatggtgcactaaatggtagaaattccattaagtaaagcacacctgaaaaaataaaactgttacacgctccacatacatgttaagtgtttatttcatagtcattctgttccttttgtaacttgctgctaatcttgttacaactctcatcattagtgctcaaaccaatgcaaagattgaagaacttctccaagaggaccacaatgctaaacgtagacgggagaagtaccaaaaacaatcatctctattgtcaaagcttactcgtcagcttagtatccatgacaatagagcttctgttgcatcgtataccaatgatagttctggagctggtaagttggctacatttcaaatacttagttgatagtagcaaatgcaatagttttgtgtgcttgcaaatttgtccatttcttttgtaggtgtgttttcttttcttctgaactttaattggttgttttcccatcataatattgagttttcctagtctattttctgcaagccaatggaatttactacgatggccatgtttgaaaccttgttgaattacaactcatctgatcatgaccataattgttctgccacatgaacaagcacttcaggacagcacgagtacatatgatggttcaactttagcagaatttgtgtgatgacaacttagcatgaaaattaagataactaaaacttagcaagtttgctttgctgcctcttcatctagggaagtattaagtagaacaccaccaatttagtgcaatcactgaaaccatcaccaaacaaattgtgtacaaatttgctcaaaatcatatgcaagggaagtgatactatattatacaacctaaatttcgatatctcaatatcataatcaatttcgtttggaagatcaaaatttgaaatttagagatagtatgctaagggtattagcacgcatcttcatgttttgcatgatcatgactgtcagcttcaaaacttcagatctcattagttcacaaacaagcctgaatactgcaatatgataggttctcatactaggtgagggttttatctaactattctgttgccattaaggttgggtcgatgatgacattgcatgcatcattttgccaaaacataagagggtaatgctggcctaggttcatgggtaacaacatcatcttggtaatctggtttatattcatggcccatgtttgccagctattcttgtcatagtttgggcattgcaattattggaaattttaatggcacaagtctgcaaccatgatttgtaaattttaacagaaatgacgataactgaacaagataaatgacctagctgatatctagctaataacaactgagcaagacagaacacttgctgttcacatttaaattttcctgcatattctagaagtgtctactatctgtgactctgtatatggattgagactgcgtagatataatggtgaatgattttgtattttcgttcatatttctttggctacctggtaggaaatatcaagcacttaatcctgactaaacaaaacaaatcatttgcagagagtagcccacggacctctggccagtcaggtgaggactggaggtctgcgttcgattctgcatcaaatggctctgttgatcgatccagttcacacaatgaaacaaggtcaagaagtgctgacagccgtggcaaacgctatgaaaatggggacgtgaatggtggtaactctggcagccgacgcacaccaaaccgtttgccaccagcacctccagggcaaaaatattaagcatgttgatcatcatccgccaacatcatattttcatgctaggtatgaagtacaacggaattgatgcatcgagaaccatttgattcagggggatggcatgcatgggctcgaagaatagagctgacgagagatttgcatgaatggtgtgtatccagaggatctcagttgttcatagaaatatactcctatagtttatctacagttgtttcacgatcattttggcatattgatctgtctgaggctcgctcagcctgtgggtgtgggattttgttaccacagatcggttgatcttggtcttgtactctgctgttgtaattcttccatcaacttggcaatgtattatttcttccattcttttt</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0738900, RefSeq:Os02g0738900