Difference between revisions of "Os04g0661200"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
 
 
The gene Os04g0661200 encodes myo-inositol-1,2,3,4,5,6-hexakisphosphate or IP6. Phytic acid (myo-inositol-1,2,3,4,5,6-hexakisphosphate or IP6) is known as the major source of phosphorus in cereal grains, comprising approximately 1–2% of the dry weight and accounting for approximately 65–80% of the total seed phosphorus.IP6 accumulates in the protein storage bodies as mixed salts called phytate that chelate a number of mineral cations. During the process of germination, endogenous grain phytase is activated, which degrades phytate, releasing stored phosphorus, myo-inositol and bound mineral cations that are further utilized by the developing seedlings. However, due to the lack of microbial phytase enzymes, monogastric animals are unable to remove the phosphates from the myo-inositol ring and are, therefore, incapable of utilizing the phosphorus present in cereals. Phytate has six negatively charged ions, making it a potent chelator of such divalent cations as Fe2+, Zn2+, Ca2+, and Mg2+ and rendering these ions unavailable for absorption by monogastric animals. In view of these adverse effects, many attempts have been made to reduce the phytic acid content in cereals.
 
The gene Os04g0661200 encodes myo-inositol-1,2,3,4,5,6-hexakisphosphate or IP6. Phytic acid (myo-inositol-1,2,3,4,5,6-hexakisphosphate or IP6) is known as the major source of phosphorus in cereal grains, comprising approximately 1–2% of the dry weight and accounting for approximately 65–80% of the total seed phosphorus.IP6 accumulates in the protein storage bodies as mixed salts called phytate that chelate a number of mineral cations. During the process of germination, endogenous grain phytase is activated, which degrades phytate, releasing stored phosphorus, myo-inositol and bound mineral cations that are further utilized by the developing seedlings. However, due to the lack of microbial phytase enzymes, monogastric animals are unable to remove the phosphates from the myo-inositol ring and are, therefore, incapable of utilizing the phosphorus present in cereals. Phytate has six negatively charged ions, making it a potent chelator of such divalent cations as Fe2+, Zn2+, Ca2+, and Mg2+ and rendering these ions unavailable for absorption by monogastric animals. In view of these adverse effects, many attempts have been made to reduce the phytic acid content in cereals.
  

Revision as of 10:24, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

The gene Os04g0661200 encodes myo-inositol-1,2,3,4,5,6-hexakisphosphate or IP6. Phytic acid (myo-inositol-1,2,3,4,5,6-hexakisphosphate or IP6) is known as the major source of phosphorus in cereal grains, comprising approximately 1–2% of the dry weight and accounting for approximately 65–80% of the total seed phosphorus.IP6 accumulates in the protein storage bodies as mixed salts called phytate that chelate a number of mineral cations. During the process of germination, endogenous grain phytase is activated, which degrades phytate, releasing stored phosphorus, myo-inositol and bound mineral cations that are further utilized by the developing seedlings. However, due to the lack of microbial phytase enzymes, monogastric animals are unable to remove the phosphates from the myo-inositol ring and are, therefore, incapable of utilizing the phosphorus present in cereals. Phytate has six negatively charged ions, making it a potent chelator of such divalent cations as Fe2+, Zn2+, Ca2+, and Mg2+ and rendering these ions unavailable for absorption by monogastric animals. In view of these adverse effects, many attempts have been made to reduce the phytic acid content in cereals.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os04g0661200

Description

Protein of unknown function DUF941 family protein

Version

NM_001060682.1 GI:115461093 GeneID:4337286

Length

4234 bp

Definition

Oryza sativa Japonica Group Os04g0661200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:34133671..34137904

Sequence Coding Region

34134016..34134162,34134307..34134894,34135134..34135244,34135321..34135361,34135974..34136118
,34136314..34136517,34137362..34137463

Expression

GEO Profiles:Os04g0661200

Genome Context

<gbrowseImage1> name=NC_008397:34133671..34137904 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:34133671..34137904 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaggtggttctgcatgagggggatgccaaagattgggtttacaaaggagaaggtgcagcgaatctaatcctcagctacactggctcgtcaccttctatgcttggcaaggttctgcgagtcaaaaagattctaaaagacaagggacaaccggcaccaaactgtatagtcttctcaagtcatgaggaacatctgtggggcaagatcccaggattgttggaatctgttaaaaatgattgcttgccacaagcctatgctacaattgttatgagccaacatttgggtgccaatcatgttgatggcggggtccgtgtacgtgtgtctaagaactttttcgagcttgctggaaagaatgtgcttgacaaccgtcctgcatggagagtgaatgctagtgcaattgatgctggagctgattctgctcttctaatttctgaccacacattattttccggtaatcctagaggaagcagttgcatagcagtggagataaaggcaaaatgtggatttcttccgtcatctgaatacatatcgaaggagaattctatcaagaaacaagtaacacggtataagatgcatcagcacctaaaatttcatctgggagagatatcgaagacaagtgaatacgatcccctagatttattttctggatcaaaagaaagaatacatatggctatcaagtcatttttttcaactcctcagaacaactttagaatttttgtggatggttctttagtttttggtggcatgggaggtggcgcagatagtgttcatcctaatgaaacagagaaatgtcttgaagatctgagcaaggttactggcttacaactatctgactttattgagctcctgtcagaggcaatctttaagtctggagtgttgggtaaacttttagccactcaaaaactggatgatcatgacatcgaaggggcgattcatctgtactataacatcatttctcagccttgtttggtatgcaaaagtataactgatacagaacttctgcgcaagtactccaccttgcattctcttccattggacaagagtgagaagattgtcagggactttcttatctctgctactgcaaaagattgtagcctaatgatcagctttcgaccaagacagagtggaacaacagattctgagtacgattctgtatttcttgattcagtgaaccaaagctatgattacaaggcatattttattgatctggatgtgaaacccttggataagatggtacattactttaaattggatcaaaagatagtcaatttctacactagaaatggagaagttgggggagatccacgtgatcctccaaagggatgtggccctaggtga</cdnaseq>

Protein Sequence

<aaseq>MEVVLHEGDAKDWVYKGEGAANLILSYTGSSPSMLGKVLRVKKI LKDKGQPAPNCIVFSSHEEHLWGKIPGLLESVKNDCLPQAYATIVMSQHLGANHVDGG VRVRVSKNFFELAGKNVLDNRPAWRVNASAIDAGADSALLISDHTLFSGNPRGSSCIA VEIKAKCGFLPSSEYISKENSIKKQVTRYKMHQHLKFHLGEISKTSEYDPLDLFSGSK ERIHMAIKSFFSTPQNNFRIFVDGSLVFGGMGGGADSVHPNETEKCLEDLSKVTGLQL SDFIELLSEAIFKSGVLGKLLATQKLDDHDIEGAIHLYYNIISQPCLVCKSITDTELL RKYSTLHSLPLDKSEKIVRDFLISATAKDCSLMISFRPRQSGTTDSEYDSVFLDSVNQ SYDYKAYFIDLDVKPLDKMVHYFKLDQKIVNFYTRNGEVGGDPRDPPKGCGPR</aaseq>

Gene Sequence

<dnaseqindica>3743..3889#3011..3598#2661..2771#2544..2584#1787..1931#1388..1591#442..543#cgctttcctcatcgtcggctccacttccacttcctcttcctcctcctcgaggacgaggaggaaattggcagctggaggcttggagcgcgctgcatcatcccgcccgccctgctgctgcggcgatcgccggagcagggctgcaggggatccccacggccgcagcagctgttgttatctggtaagcaactaaagctcgctatctgctcgacggaatgccgcaccgaccaggaaccaagtgttgcttctttctcgcttgatcttctctttggtagatgagtaaatgaatgcacctgcacttggactcgagtttgctgtgttactcggcgttaagcagcaattttctgttcctcctacttcgtttttcgcctactattcctccttacttattttgaataatagaccttgaactcatacttggaagcctgcagattctgtgtggggatggaggtggttctgcatgagggggatgccaaagattgggtttacaaaggagaaggtgcagcgaatctaatcctcagctacactggctcgtcaccttctatggtatgcatcgaataggttctgcttgtgtcattattggttactgacctatagtctcccgtaaatcggcgaatttgatgcatgtgcttcaagaaggatgttttacttttgatgttctgatgattatagctatgaatgtttgggtgtctgggaggcgacagtagttcaagctcttttcatgagatgttttggatggtgttttatgaggtgatctggagatgtagccttgtgcttgatctagctaggacccagcagttggtgtctagtcgtttctgtcctagtttagctagctgtttttattttcctataagactctgtttgtttggctttcctcacaaagccggtttaatgaatgcctgatttccccccaaaaagatgttttaccaactttgatgcaacgcccagggatgcatgtcctatggccagagctgcactcttgaaatggcaaatgtttgtatatgtaaattagaaaatcccatacagctttcatgtagtcaaatagtttcactttaatattatataattcaaaagaaaataatcttagttgtgtgatcacacaaaaagaaggggtggtggcggcgccatcttagttgtgtgatctgcctgcccggtctagttttgtttttttgttcaattccttttgctgtattgctacaacattgttgtttcctgtaatggaaagagggagagcaaggttcttctgttttttaaaagaagagaggaaaaagagaaaataatcttatcttgacttggttgactaaaatttttagtttgtgaccaaagtattatgtttccctcgtatgatatgtttacaggaaaaatgttttgatgatgttttcttgaacagcttggcaaggttctgcgagtcaaaaagattctaaaagacaagggacaaccggcaccaaactgtatagtcttctcaagtcatgaggaacatctgtggggcaagatcccaggattgttggaatctgttaaaaatgattgcttgccacaagcctatgctacaattgttatgagccaacatttgggtgccaatcatgttgatggcggggtatgttttaaatccaattatttaatgttgttacggtgatatttattagaaataaatcaaccaacgttttccaatttaaaattcttttgctctataattaatggaaaattcgggttatttgaaaatacatccttgattagataattggatccacttgactaaaatgaataaacgtggtctctttttcatgttcaggtccgtgtacgtgtgtctaagaactttttcgagcttgctggaaagaatgtgcttgacaaccgtcctgcatggagagtgaatgctagtgcaattgatgctggagctgattctgctcttctaatttctgaccacacattattttccggtaaagtcttggcgtttcaatgttatttgaacgcttcatctctttcccttttgagtataatgtgactcttgtttgtactaagaaagagcaaatatcagttaggtctggtgatctattaactctttatgatataacatttgcagcaacactgttactcagtttattatttctatttgcatcacatgctttaaccttatttgtttgttaagagtggcaagtttgtaatttatggttttctagtctacaaccaaatagataggatcaagattggtaagcccaactttctccatgacacttgtgaaacttgggatatgtttggaaggattcatacaatttatatttctcaagattctccattattctgaaacatggaaagaatgaaagaacctgcttgttttttcgaatttctagcttaactctgatctgttccatccgcaagagcttgtttccgtcctaaaattggtagttggtccaaaattgattagtttgaatgattaaagatgattcggtagttttttacattgcgccattgctaaattattattcgtaactcgctgctagattttgttttttaacactatgtttgtttttggtaatttttctaaacctcaggtaatcctagaggaagcagttgcatagcagtggagataaaggtacattttgagctttatttatttcttcactgttcatcttttgtacacatttcttttaacatgctttgccttccaggcaaaatgtggatttcttccgtcatctgaatacatatcgaaggagaattctatcaagaaacaagtaacacggtataagatgcatcagcacctaaaatttcatctgggagaggtatgttggttttgggtaccagattttgatttcaccgcagccataattttgagtactaaatatataatagcacactactcttttgctcactgaaagacaacaaactactcttctagctgaaacagatattaatagatgcttcatattcattctgtcactcttggaagttgcaatgctatatcatcccttttgcttttcaaatcagcttggttctaaacatatttttaaacacatttcagatatcgaagacaagtgaatacgatcccctagatttattttctggatcaaaagaaagaatacatatggctatcaagtcatttttttcaactcctcagaacaactttagaatttttgtggatggttctttagtttttggtggcatgggaggtggcgcagatagtgttcatcctaatgaaacagagaaatgtcttgaagatctgagcaaggttactggcttacaactatctgactttattgagctcctgtcagaggcaatctttaagtctggagtgttgggtaaacttttagccactcaaaaactggatgatcatgacatcgaaggggcgattcatctgtactataacatcatttctcagccttgtttggtatgcaaaagtataactgatacagaacttctgcgcaagtactccaccttgcattctcttccattggacaagagtgagaagattgtcagggactttcttatctctgctactgcaaaagattgtagcctaatgatcagctttcgaccaagacagagtggaacaacagattctgagtacgattctgtatttcttgattcagtgaaccaaagctatgattacaaggtattgatgtgatatgtttcttgtttgagaagttcgataagtcatctagttccttgtggaacaattgtttttttctttctaaaaactctttttattaatgtttctttcccaccaacccattgatttgcacatttgttgttgcaggcatattttattgatctggatgtgaaacccttggataagatggtacattactttaaattggatcaaaagatagtcaatttctacactagaaatggagaagttgggggagatccacgtgatcctccaaagggatgtggccctaggtgacacaaaggttcagctccaaaggttcagctccaacattgacgaccttgaaatataaagggcataggacaagtgtctgttgtatcttggtgattgttgtgtttctacaagtgtgcatgtccaatgtgcaggttctcctcccttctagggaaaacgtgtaagagagtggtagttgttgtagtacatcctgtataccgtgtggtttgcctcagcagtaggccgaattttcagtagacaaacattaagaagagttaataaactgtatactgaggcatccacgtttaccttggaaatctatgataaattcccgtatactcagcttgctgtgaatctgtgatctgagttctg</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0661200, RefSeq:Os04g0661200