Difference between revisions of "Os07g0182900"

From RiceWiki
Jump to: navigation, search
(Mutation assay)
(Mutation assay)
Line 15: Line 15:
 
[[File:Figure 1.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds.png]]
 
[[File:Figure 1.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds.png]]
  
Figure 1.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds
+
Figure 1.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds
  
 
===Expression===
 
===Expression===

Revision as of 10:42, 4 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. DNA methytransferase (OsMET1) genes from rice (Oryza sativa L) have two types, OsMET1a and OsMET1b, on chromosomes 3 and 7, respectively, each encoding a cytosine-5 DNA methyltransferase (MTase), which are mainly responsible for maintaining CG dinucleotide methylation after DNA replication.OsMET1 is a plant homolog of mammalian DNA methyltransferase1(DNMT1), and MET1b plays a major role in the maintenance DNA methylation compared to MET1a, which is indispensable for the normal development of embryos in rice.

Sequence comparison between OsMET1a and OsMET1b

OsMET1a has an open reading frame of 4,566 nucleotides with 12 exons and 11 introns while OsMET1b has an open reading frame of 4,491; nucleotides with 11 exons and 10 introns. Although OsMET1a and OsMET1b have high sequence similarity overall, they share only 24%; dentity in exon 1, and intron 3 of OsMET1a is absent from OsMET1b.

Mutation assay

  • RNAi-mediated knockdown analysis of the rice MET1 genes showed that it resulted in reactivation of a silenced β-glucuronidase (GUS) transgene in rice callus.
  • A Osmet1a null mutant has no obvious phenotypes, while Osmet1b null mutant exhibited abnormal seed phenotypes, such as early embryonic lethality, decreased levels of DNA methylation at repetitive CentO sequences and at the FIEI gene locus in the embryos.

Figure 1.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds.png

Figure 1.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds

Expression

Please input expression information here.

  • Ribonuclease protection assays showed that MET1a and MET1b both express in highly replicating and dividing cells;
  • MET1b is more abundantly expressed than MET1a in all of the tissues examined, like callus, root and inflorescence.
  • OsMET1b does not express in differentiated tissue (10-day-old leaf), and no expression for either gene was found in mature leaves.

Evolution

Please input evolution information here. This phylogenetic relationships between eukaryotic and prokaryotic DNA methytransferase were derived using the AlignX program of the VectorNTI suite, suggesting that the rice DNA methytransferase are related to DNA methytransferase of Dnmt1/MET1 class in diverse organisms from several kingdom.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os07g0182900

Description

Similar to Cytosine-5 DNA methyltransferase MET1 (Fragment)

Version

NM_001065587.1 GI:115470906 GeneID:4342575

Length

2298 bp

Definition

Oryza sativa Japonica Group Os07g0182900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:4421779..4424076

Sequence Coding Region

4421780..4421864,4421955..4422066,4422154..4422301,4422417..4422614,4422710..4422988
,4423084..4423245,4423344..4423562,4423676..4423810

Expression

GEO Profiles:Os07g0182900

Genome Context

<gbrowseImage1> name=NC_008400:4421779..4424076 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:4421779..4424076 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>acaaaggtgtccaaagagaaccgtcttgcaactcttgacatttttgctggctgtggaggtttatcagaaggactgcagcaagctggtgtatcgtttacaaagtgggcgattgaatatgaggaaccagctggtgaagcatttaccaaaaatcatccagaagctgcggtgtttgtggataactgcaatgtgattttgaaggcaattatggacaaatgtggagatgctgatgattgcatttcaacttctgaggctgctgaacaagcagctaaattttctcaggacaatattatgaaccttcctgtccctggtgaagtagaattcataaatggtggtcctccatgtcagggcttttctgggatgaacagatttaaccaaagcccatggagtaaagttcaatgtgagatgattttagcattcctgtcttttgctgaatatttccgccccagattctttcttttagaaaatgttaggaactttgtttcattcaacaaaggacagacatttcgactgacagttgcatcccttctggagatgggataccaggtccggtttggaattttagaggcagggacttttggtgttgctcagtccaggaaaagagcattcatttgggctgctgcacctggagagactctgcctgattggccagaaccaatgcatgtgtttgctagccctgagctgaaaataaatttgcctgatggtaaatactatgcagctgcaaaaagcactgctggtggtgctcctttccgtgcaataacagttagagatacaataggcgatttaccaaaggtggagaatggcgccagtaaactcctacttgagtacggtggcgaacccatctcctggttccagaagaagattagagggaacacgatcgcgctgaatgatcacatatctaaggagatgaatgaactgaacctcatcagatgccaacgcattccaaagcggcctggttgtgattggcatgacctaccagatgagaaggtgaaactatcatctggccaactggtggacctgatcccttggtgcctgcctaacacagctaaaaggcacaaccagtggaaagggctttatggtaggctggattgggagggcaatttccctacttctgtgacagacccccagccaatgggcaaggttggcatgtgcttccaccctgaccaggataggatcatcacagtccgtgaatgtgcgcgatctcagggctttcctgacaactaccagttcgcgggcaacatccagagcaagcacaggcagattggcaatgcggtgcctccacctcttgccttcgccctcgggaggaaactgaaggaagctgttgatgcaaagcgtcagtag</cdnaseq>

Protein Sequence

<aaseq>TKVSKENRLATLDIFAGCGGLSEGLQQAGVSFTKWAIEYEEPAG EAFTKNHPEAAVFVDNCNVILKAIMDKCGDADDCISTSEAAEQAAKFSQDNIMNLPVP GEVEFINGGPPCQGFSGMNRFNQSPWSKVQCEMILAFLSFAEYFRPRFFLLENVRNFV SFNKGQTFRLTVASLLEMGYQVRFGILEAGTFGVAQSRKRAFIWAAAPGETLPDWPEP MHVFASPELKINLPDGKYYAAAKSTAGGAPFRAITVRDTIGDLPKVENGASKLLLEYG GEPISWFQKKIRGNTIALNDHISKEMNELNLIRCQRIPKRPGCDWHDLPDEKVKLSSG QLVDLIPWCLPNTAKRHNQWKGLYGRLDWEGNFPTSVTDPQPMGKVGMCFHPDQDRII TVRECARSQGFPDNYQFAGNIQSKHRQIGNAVPPPLAFALGRKLKEAVDAKRQ</aaseq>

Gene Sequence

<dnaseqindica>2..86#177..288#376..523#639..836#932..1210#1306..1467#1566..1784#1898..2032#tacaaaggtgtccaaagagaaccgtcttgcaactcttgacatttttgctggctgtggaggtttatcagaaggactgcagcaagctggtatgcactttccttcaataatggtgtttagctttatcatcaacatgtcggccatcagactgatattttattaccatttaaattctgtaggtgtatcgtttacaaagtgggcgattgaatatgaggaaccagctggtgaagcatttaccaaaaatcatccagaagctgcggtgtttgtggataactgcaatgtgattttgaagtaggtgcaccgtgcacttccttgattttttctgtggttttctttttacctatatagctcaatagggactgttatatgattttgcagggcaattatggacaaatgtggagatgctgatgattgcatttcaacttctgaggctgctgaacaagcagctaaattttctcaggacaatattatgaaccttcctgtccctggtgaagtagaattcataaatggtggtcctccatgtcaggtatattattttgctatacttgatggaattttctttgcacctaggcaagcaaattgtttgcacttcaatacttgtgataaatgacttcaattttgtaatttttttctcaactcagggcttttctgggatgaacagatttaaccaaagcccatggagtaaagttcaatgtgagatgattttagcattcctgtcttttgctgaatatttccgccccagattctttcttttagaaaatgttaggaactttgtttcattcaacaaaggacagacatttcgactgacagttgcatcccttctggagatgggataccaggtaattattcttctggttatacatacttaaaatgcctatgtacagcatttgttttgaatcttataataaccagaagctgtttacttgttgcttaggtccggtttggaattttagaggcagggacttttggtgttgctcagtccaggaaaagagcattcatttgggctgctgcacctggagagactctgcctgattggccagaaccaatgcatgtgtttgctagccctgagctgaaaataaatttgcctgatggtaaatactatgcagctgcaaaaagcactgctggtggtgctcctttccgtgcaataacagttagagatacaataggcgatttaccaaaggtggagaatggcgccagtaaactcctacttgaggtaaaattgcttctcctatatggctatccgctccattttatcctgtttcttctcttgatttatatgctgaatgaatcccctcttttgtaatgcagtacggtggcgaacccatctcctggttccagaagaagattagagggaacacgatcgcgctgaatgatcacatatctaaggagatgaatgaactgaacctcatcagatgccaacgcattccaaagcggcctggttgtgattggcatgacctaccagatgagaaggtaaatgccatctaccttgcggttgcattcacttccttttgtgctcttccatacattccttgcatcagcggaatgttaaccattatgagcgtgtgcaggtgaaactatcatctggccaactggtggacctgatcccttggtgcctgcctaacacagctaaaaggcacaaccagtggaaagggctttatggtaggctggattgggagggcaatttccctacttctgtgacagacccccagccaatgggcaaggttggcatgtgcttccaccctgaccaggataggatcatcacagtccgtgaatgtgcgcgatctcaggtaagctgctattgctatccatccattcaacattctcttcctgtcttctaagatattgtgaatttggaggggagtcagtactgaccgtttaactaacctattcttgtctgcagggctttcctgacaactaccagttcgcgggcaacatccagagcaagcacaggcagattggcaatgcggtgcctccacctcttgccttcgccctcgggaggaaactgaaggaagctgttgatgcaaagcgtcagtaggtgctcagagtccttctccgatgatcgagggagatgattctcccctgaaaagaaacaaacaaccaaacatatgagtgtacttattttaattgtgcgctgcatttaactttgtgtgttgattaagattttagtcatatagatccttggtaaccttgtacattttagaggttgtgttgtgattgatacccttgattcaggggtatgatttagtggctgtattcagatatttaaacaaaataatactagttagtgatggttgaattgtt</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0182900, RefSeq:Os07g0182900