Difference between revisions of "Os07g0182900"
Ibpchenwenbo (talk | contribs) (→Sequence comparison between OsMET1a and OsMET1b) |
Ibpchenwenbo (talk | contribs) (→Sequence comparison between OsMET1a and OsMET1b) |
||
| Line 11: | Line 11: | ||
*The amino acid sequence downstream of the lysine–glycine repeat motif in OsMET1a showed a higher conservation (86.5%) with that of OsMET1b than did that (67.7%) for the N terminal domain (residues 1–1059). The inferred amino acid sequences of OsMET1a and OsMET1b contain several functional regions. | *The amino acid sequence downstream of the lysine–glycine repeat motif in OsMET1a showed a higher conservation (86.5%) with that of OsMET1b than did that (67.7%) for the N terminal domain (residues 1–1059). The inferred amino acid sequences of OsMET1a and OsMET1b contain several functional regions. | ||
[[File:1.png]] | [[File:1.png]] | ||
| − | Figure 1:Proportionate diagram of OsMET1-1 showing conserved domains: S-stretch serine-rich region; E-rich region glutamic acid-rich region; BAH bromo adjacent homology domain (black boxes with white dots); IQ motif (calmodulin binding) isoleucine (I) and glutamine (Q) motif (hatched box); NLS putative nuclear localization signal (oval); KG linker the lysine-glycine repeat, KNKGKG (gray box); I to X the catalytic domain with eight highly conserved DNA MTase motifs (black bars). | + | Figure 1:Proportionate diagram of OsMET1-1 showing conserved domains: S-stretch serine-rich region; E-rich region glutamic acid-rich region; BAH bromo adjacent homology domain (black boxes with white dots); IQ motif (calmodulin binding) isoleucine (I) and glutamine (Q) motif (hatched box); NLS putative nuclear localization signal (oval); KG linker the lysine-glycine repeat, KNKGKG (gray box); I to X the catalytic domain with eight highly conserved DNA MTase motifs (black bars). |
===Mutation assay=== | ===Mutation assay=== | ||
Revision as of 13:56, 4 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
DNA methylation is a heritable epigenetic mark that regulates expression of genes involved in developmental processes DNA. In mammals, DNA methylation predominantly occurs in CG dinucleotides and is maintained by DNA methyltransferase1, While in plants, CG methylation is maintained by methyltransferase1(MET1).DNA methytransferase (OsMET1) genes from rice (Oryza sativa L) have two types, OsMET1a and OsMET1b, on chromosomes 3 and 7, respectively, each encoding a cytosine-5 DNA methyltransferase (MTase), which are mainly responsible for maintaining CG dinucleotide methylation after DNA replication.OsMET1 is a plant homolog of mammalian DNA methyltransferase1(DNMT1), and MET1b plays a major role in the maintenance DNA methylation compared to MET1a, which is indispensable for the normal development of embryos in rice.
Sequence comparison between OsMET1a and OsMET1b
- OsMET1a has an open reading frame of 4,566 nucleotides with 12 exons and 11 introns while OsMET1b has an open reading frame of 4,491; nucleotides with 11 exons and 10 introns. Although OsMET1a and OsMET1b have high sequence similarity overall, they share only 24%; dentity in exon 1, and intron 3 of OsMET1a is absent from OsMET1b.
- A lysine–glycine repeat that is highly conserved in DNA MTases is present two-thirds of the way through the protein, separating the catalytic and regulatory domains in both OsMET1a and OsMET1b.
- The amino acid sequence downstream of the lysine–glycine repeat motif in OsMET1a showed a higher conservation (86.5%) with that of OsMET1b than did that (67.7%) for the N terminal domain (residues 1–1059). The inferred amino acid sequences of OsMET1a and OsMET1b contain several functional regions.
Figure 1:Proportionate diagram of OsMET1-1 showing conserved domains: S-stretch serine-rich region; E-rich region glutamic acid-rich region; BAH bromo adjacent homology domain (black boxes with white dots); IQ motif (calmodulin binding) isoleucine (I) and glutamine (Q) motif (hatched box); NLS putative nuclear localization signal (oval); KG linker the lysine-glycine repeat, KNKGKG (gray box); I to X the catalytic domain with eight highly conserved DNA MTase motifs (black bars).
Mutation assay
- RNAi-mediated knockdown analysis of the rice MET1 genes showed that it resulted in reactivation of a silenced β-glucuronidase (GUS) transgene in rice callus.
- A Osmet1a null mutant has no obvious phenotypes, while Osmet1b null mutant exhibited abnormal seed phenotypes, such as early embryonic lethality, decreased levels of DNA methylation at repetitive CentO sequences and at the FIEI gene locus in the embryos.
_seeds.png)
Figure 1.Phenotyes of normal type seeds and OsMET1b null mutant type(A to C) seeds
Expression
- Ribonuclease protection assays showed that MET1a and MET1b both express in highly replicating and dividing cells;
- MET1b is more abundantly expressed than MET1a in all of the tissues examined, like callus, root and inflorescence.
- OsMET1b does not express in differentiated tissue (10-day-old leaf), and no expression for either gene was found in mature leaves.
Evolution
This phylogenetic relationships between eukaryotic and prokaryotic DNA methytransferase were derived using the AlignX program of the VectorNTI suite, suggesting that the rice DNA methytransferase are related to DNA methytransferase of Dnmt1/MET1 class in diverse organisms from several kingdom.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os07g0182900 |
|---|---|
| Description |
Similar to Cytosine-5 DNA methyltransferase MET1 (Fragment) |
| Version |
NM_001065587.1 GI:115470906 GeneID:4342575 |
| Length |
2298 bp |
| Definition |
Oryza sativa Japonica Group Os07g0182900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 7:4421779..4424076 |
| Sequence Coding Region |
4421780..4421864,4421955..4422066,4422154..4422301,4422417..4422614,4422710..4422988 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008400:4421779..4424076 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008400:4421779..4424076 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>acaaaggtgtccaaagagaaccgtcttgcaactcttgacatttttgctggctgtggaggtttatcagaaggactgcagcaagctggtgtatcgtttacaaagtgggcgattgaatatgaggaaccagctggtgaagcatttaccaaaaatcatccagaagctgcggtgtttgtggataactgcaatgtgattttgaaggcaattatggacaaatgtggagatgctgatgattgcatttcaacttctgaggctgctgaacaagcagctaaattttctcaggacaatattatgaaccttcctgtccctggtgaagtagaattcataaatggtggtcctccatgtcagggcttttctgggatgaacagatttaaccaaagcccatggagtaaagttcaatgtgagatgattttagcattcctgtcttttgctgaatatttccgccccagattctttcttttagaaaatgttaggaactttgtttcattcaacaaaggacagacatttcgactgacagttgcatcccttctggagatgggataccaggtccggtttggaattttagaggcagggacttttggtgttgctcagtccaggaaaagagcattcatttgggctgctgcacctggagagactctgcctgattggccagaaccaatgcatgtgtttgctagccctgagctgaaaataaatttgcctgatggtaaatactatgcagctgcaaaaagcactgctggtggtgctcctttccgtgcaataacagttagagatacaataggcgatttaccaaaggtggagaatggcgccagtaaactcctacttgagtacggtggcgaacccatctcctggttccagaagaagattagagggaacacgatcgcgctgaatgatcacatatctaaggagatgaatgaactgaacctcatcagatgccaacgcattccaaagcggcctggttgtgattggcatgacctaccagatgagaaggtgaaactatcatctggccaactggtggacctgatcccttggtgcctgcctaacacagctaaaaggcacaaccagtggaaagggctttatggtaggctggattgggagggcaatttccctacttctgtgacagacccccagccaatgggcaaggttggcatgtgcttccaccctgaccaggataggatcatcacagtccgtgaatgtgcgcgatctcagggctttcctgacaactaccagttcgcgggcaacatccagagcaagcacaggcagattggcaatgcggtgcctccacctcttgccttcgccctcgggaggaaactgaaggaagctgttgatgcaaagcgtcagtag</cdnaseq> |
| Protein Sequence |
<aaseq>TKVSKENRLATLDIFAGCGGLSEGLQQAGVSFTKWAIEYEEPAG EAFTKNHPEAAVFVDNCNVILKAIMDKCGDADDCISTSEAAEQAAKFSQDNIMNLPVP GEVEFINGGPPCQGFSGMNRFNQSPWSKVQCEMILAFLSFAEYFRPRFFLLENVRNFV SFNKGQTFRLTVASLLEMGYQVRFGILEAGTFGVAQSRKRAFIWAAAPGETLPDWPEP MHVFASPELKINLPDGKYYAAAKSTAGGAPFRAITVRDTIGDLPKVENGASKLLLEYG GEPISWFQKKIRGNTIALNDHISKEMNELNLIRCQRIPKRPGCDWHDLPDEKVKLSSG QLVDLIPWCLPNTAKRHNQWKGLYGRLDWEGNFPTSVTDPQPMGKVGMCFHPDQDRII TVRECARSQGFPDNYQFAGNIQSKHRQIGNAVPPPLAFALGRKLKEAVDAKRQ</aaseq> |
| Gene Sequence |
<dnaseqindica>2..86#177..288#376..523#639..836#932..1210#1306..1467#1566..1784#1898..2032#tacaaaggtgtccaaagagaaccgtcttgcaactcttgacatttttgctggctgtggaggtttatcagaaggactgcagcaagctggtatgcactttccttcaataatggtgtttagctttatcatcaacatgtcggccatcagactgatattttattaccatttaaattctgtaggtgtatcgtttacaaagtgggcgattgaatatgaggaaccagctggtgaagcatttaccaaaaatcatccagaagctgcggtgtttgtggataactgcaatgtgattttgaagtaggtgcaccgtgcacttccttgattttttctgtggttttctttttacctatatagctcaatagggactgttatatgattttgcagggcaattatggacaaatgtggagatgctgatgattgcatttcaacttctgaggctgctgaacaagcagctaaattttctcaggacaatattatgaaccttcctgtccctggtgaagtagaattcataaatggtggtcctccatgtcaggtatattattttgctatacttgatggaattttctttgcacctaggcaagcaaattgtttgcacttcaatacttgtgataaatgacttcaattttgtaatttttttctcaactcagggcttttctgggatgaacagatttaaccaaagcccatggagtaaagttcaatgtgagatgattttagcattcctgtcttttgctgaatatttccgccccagattctttcttttagaaaatgttaggaactttgtttcattcaacaaaggacagacatttcgactgacagttgcatcccttctggagatgggataccaggtaattattcttctggttatacatacttaaaatgcctatgtacagcatttgttttgaatcttataataaccagaagctgtttacttgttgcttaggtccggtttggaattttagaggcagggacttttggtgttgctcagtccaggaaaagagcattcatttgggctgctgcacctggagagactctgcctgattggccagaaccaatgcatgtgtttgctagccctgagctgaaaataaatttgcctgatggtaaatactatgcagctgcaaaaagcactgctggtggtgctcctttccgtgcaataacagttagagatacaataggcgatttaccaaaggtggagaatggcgccagtaaactcctacttgaggtaaaattgcttctcctatatggctatccgctccattttatcctgtttcttctcttgatttatatgctgaatgaatcccctcttttgtaatgcagtacggtggcgaacccatctcctggttccagaagaagattagagggaacacgatcgcgctgaatgatcacatatctaaggagatgaatgaactgaacctcatcagatgccaacgcattccaaagcggcctggttgtgattggcatgacctaccagatgagaaggtaaatgccatctaccttgcggttgcattcacttccttttgtgctcttccatacattccttgcatcagcggaatgttaaccattatgagcgtgtgcaggtgaaactatcatctggccaactggtggacctgatcccttggtgcctgcctaacacagctaaaaggcacaaccagtggaaagggctttatggtaggctggattgggagggcaatttccctacttctgtgacagacccccagccaatgggcaaggttggcatgtgcttccaccctgaccaggataggatcatcacagtccgtgaatgtgcgcgatctcaggtaagctgctattgctatccatccattcaacattctcttcctgtcttctaagatattgtgaatttggaggggagtcagtactgaccgtttaactaacctattcttgtctgcagggctttcctgacaactaccagttcgcgggcaacatccagagcaagcacaggcagattggcaatgcggtgcctccacctcttgccttcgccctcgggaggaaactgaaggaagctgttgatgcaaagcgtcagtaggtgctcagagtccttctccgatgatcgagggagatgattctcccctgaaaagaaacaaacaaccaaacatatgagtgtacttattttaattgtgcgctgcatttaactttgtgtgttgattaagattttagtcatatagatccttggtaaccttgtacattttagaggttgtgttgtgattgatacccttgattcaggggtatgatttagtggctgtattcagatatttaaacaaaataatactagttagtgatggttgaattgtt</dnaseqindica> |
| External Link(s) |
