Difference between revisions of "Os01g0227100"

From RiceWiki
Jump to: navigation, search
(nyc1 is a recessive mutant in rice and it canretain green leaves during senescence)
Line 1: Line 1:
 
Please input one-sentence summary here.
 
Please input one-sentence summary here.
−
 
+
nyc1 is a recessive mutant in rice and it canretain green leaves during senescence.
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Line 6: Line 6:
 
The symbol of the gene “Os01g0227100” is NYC1.
 
The symbol of the gene “Os01g0227100” is NYC1.
 
nyc1 is a recessive mutant in rice, nyc1 was isolated as a stay-green mutant in the paddy field. nyc1 remains green until just before death in natural senescence and does not show yellowing.In nyc1, most light-harvesting complex II(LHCII )members are selectively retained during senescence, in contrast with the wild type. nyc1retains granal structure during senescence.
 
nyc1 is a recessive mutant in rice, nyc1 was isolated as a stay-green mutant in the paddy field. nyc1 remains green until just before death in natural senescence and does not show yellowing.In nyc1, most light-harvesting complex II(LHCII )members are selectively retained during senescence, in contrast with the wild type. nyc1retains granal structure during senescence.
−
1.Inhibition of LHCP Degradation in nyc1
+
1.Inhibition of LHCP Degradation in nyc1.
−
  In wild-type senescent leaves, the abundance of these protein complexes was reduced remarkably at 5 DDI;In nyc1, the abundances of chlorophyll abinding proteins, LHCP dimer (whose major component is LHCI), PSI reaction center complex, and CP43/47 were reduced to similar levels as in the wild type at 5 and 7 DDI, but the LHCP trimer and monomer were apparent even at 7 DDI.图
+
  In wild-type senescent leaves, the abundance of these protein complexes was reduced remarkably at 5 DDI;In nyc1, the abundances of chlorophyll abinding proteins, LHCP dimer (whose major component is LHCI), PSI reaction center complex, and CP43/47 were reduced to similar levels as in the wild type at 5 and 7 DDI, but the LHCP trimer and monomer were apparent even at 7 DDI.  
 
2.Inhibition of Degradation of Pigments Strongly Bound to LHCP in nyc1.
 
2.Inhibition of Degradation of Pigments Strongly Bound to LHCP in nyc1.
−
By 8 DDI, the amounts of most photosynthetic pigments exceptb-carotene were significantly reduced in the wild type. In nyc1, the degradation of not only chlorophyllaand chlorophyllbbut also neoxanthin and lutein was apparently inhibited.  
+
By 8 DDI, the amounts of most photosynthetic pigments exceptb-carotene were significantly reduced in the wild type. In nyc1, the degradation of not only chlorophyllaand chlorophyllbbut also neoxanthin and lutein was apparently inhibited.
−
3.NYC1 is Required for Proper Chloroplast Degeneration。
+
3. the degradation of chlorophyll b was severely inhibited and light-harvesting complex II was selectively retained during senescence, resulting in the retention of thylakoid grana even at a late stage of senescence.
−
The grana stacks are stable during senescence innyc1, unlike in the wild type.
+
4.The protein encoded by NYC1 is necessary for catalyzing the first step of chlorophyll b degradation. Analysis of the nyc1 mutant, which shows the stay-green phenotype, revealed that chlorophyll b degradation is required for the degradation of light-harvesting complex II and thylakoid grana in leaf senescence.  
 +
 
  
 
===Expression===
 
===Expression===
 
Please input expression information here.
 
Please input expression information here.
−
nyc1 was located between cleaved-amplified polymorphic sequence (CAPS) markers P0443E07.24 and P0452F10.5. Five genes were predicted in this≈40-kb region. One of them seems to encode a member of the short-chain dehydrogenase/reductase (SDR) family . Sequence analysis of thenyc1-1allele revealed a single base pair change, a G-to-A substitution, at the first exon/first intron junction, which may prevent splicing of the first intron and result in the early termination of translation.
+
nyc1 was located between cleaved-amplified polymorphic sequence (CAPS) markers P0443E07.24 and P0452F10.5. Five genes were predicted in this≈40-kb region. One of them seems to encode encodes a protein with 504 amino acids belonging to the SDR family.The amino acid sequence of NYC1 contains all important amino acid residues conserved in the classical SDR family, including a dinucleotide binding motif (TGXXXGXG) and a catalytic site (YXXXK). NYC1 has an Arg at key position 15 (180th amino acid) and another at key position 37 (202nd amino acid). Sequence analysis of the nyc1-1 allele revealed a single base pair change, a G-to-A substitution, at the first exon/first intron junction, which may prevent splicing of the first intron and result in the early termination of translation.
 
===Evolution===
 
===Evolution===
 
Please input evolution information here.
 
Please input evolution information here.

Revision as of 15:26, 4 June 2014

Please input one-sentence summary here. nyc1 is a recessive mutant in rice and it canretain green leaves during senescence.

Annotated Information

Function

Please input function information here. The symbol of the gene “Os01g0227100” is NYC1. nyc1 is a recessive mutant in rice, nyc1 was isolated as a stay-green mutant in the paddy field. nyc1 remains green until just before death in natural senescence and does not show yellowing.In nyc1, most light-harvesting complex II(LHCII )members are selectively retained during senescence, in contrast with the wild type. nyc1retains granal structure during senescence. 1.Inhibition of LHCP Degradation in nyc1.

In wild-type senescent leaves, the abundance of these protein complexes was reduced remarkably at 5 DDI;In nyc1, the abundances of chlorophyll abinding proteins, LHCP dimer (whose major component is LHCI), PSI reaction center complex, and CP43/47 were reduced to similar levels as in the wild type at 5 and 7 DDI, but the LHCP trimer and monomer were apparent even at 7 DDI. 

2.Inhibition of Degradation of Pigments Strongly Bound to LHCP in nyc1. By 8 DDI, the amounts of most photosynthetic pigments exceptb-carotene were significantly reduced in the wild type. In nyc1, the degradation of not only chlorophyllaand chlorophyllbbut also neoxanthin and lutein was apparently inhibited. 3. the degradation of chlorophyll b was severely inhibited and light-harvesting complex II was selectively retained during senescence, resulting in the retention of thylakoid grana even at a late stage of senescence. 4.The protein encoded by NYC1 is necessary for catalyzing the first step of chlorophyll b degradation. Analysis of the nyc1 mutant, which shows the stay-green phenotype, revealed that chlorophyll b degradation is required for the degradation of light-harvesting complex II and thylakoid grana in leaf senescence.


Expression

Please input expression information here. nyc1 was located between cleaved-amplified polymorphic sequence (CAPS) markers P0443E07.24 and P0452F10.5. Five genes were predicted in this≈40-kb region. One of them seems to encode encodes a protein with 504 amino acids belonging to the SDR family.The amino acid sequence of NYC1 contains all important amino acid residues conserved in the classical SDR family, including a dinucleotide binding motif (TGXXXGXG) and a catalytic site (YXXXK). NYC1 has an Arg at key position 15 (180th amino acid) and another at key position 37 (202nd amino acid). Sequence analysis of the nyc1-1 allele revealed a single base pair change, a G-to-A substitution, at the first exon/first intron junction, which may prevent splicing of the first intron and result in the early termination of translation.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. Graduate School of Agricultural and Life Sciences, University of Tokyo. Institute of Low-Temperature Science, Hokkaido University. Institute of Radiation Breeding, National Institute of Agrobiological Sciences. Chugoku National Agricultural Research Center for WesternRegion, National Agriculture and Bio-oriented Research Organization.

References

Please input cited references here.

[1] Yutaka Sato1,+, Ryouhei Morita2, Susumu Katsuma1, Minoru Nishimura2, Ayumi Tanaka3 and Makoto Kusaba1,4,*(2009)Rice NON-YELLOW COLORING1 Is Involved in Light-Harvesting Complex II and Grana Degradation during Leaf Senescence.The Plant Journal.57:121-130.

[2]Makoto Kusaba,a,1Hisashi Ito,b Ryouhei Morita,cShuichi Iida,dYutaka Sato,aMasaru Fujimoto,aShinji Kawasaki,eRyouichi Tanaka,bHirohiko Hirochika,eMinoru Nishimura,cand Ayumi Tanakab(2007)Two short-chain dehydrogenase/reductases, NON-YELLOW COLORING 1 and NYC1-LIKE, are required for chlorophyll b and light-harvesting complex II degradation during senescence in rice.The Plant Cell.19: 1362–1375.

Structured Information

Gene Name

Os01g0227100

Description

Glucose/ribitol dehydrogenase family protein

Version

NM_001049003.1 GI:115435419 GeneID:4327178

Length

6295 bp

Definition

Oryza sativa Japonica Group Os01g0227100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:7023277..7029571

Sequence Coding Region

7023363..7023680,7024607..7024685,7024796..7024931,7025304..7025378,7025493..7025688
,7025875..7025943,7026095..7026234,7026405..7026527,7027370..7027562
,7028852..7029037

Expression

GEO Profiles:Os01g0227100

Genome Context

<gbrowseImage1> name=NC_008394:7023277..7029571 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:7023277..7029571 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccgccgccgcggtggtccacctctccgtgcacggccgcctccgccgctcgccggagctccacgcccggccataccaccgcccgtcgctgctccggtgccgcgcgttcaagcaggaggccgataacggcggggaggaggcttcgtcgtcgccgccgccgccgacgacggccgaggcgcggaggcgcaggaagggcccgctgtacaagctgaaggcggcgattcaggggctcgccgggtcgcggtcggcggccgcggaggcgtacgggggcgagtaccagcgcgccgtcgagaaggccgaggagatcttcttctcggttgctacgcaagtaggccgatatgttatcactatgatgagcagcggtgttgtacttggagttggatttcagttatcaggcggagacagccaaatgaatacactaatttggtatagttggctcgggggagtaattattggcacgatgataggtgcaaacagtgtcctagaggaacactgcaaagctggacctcgcaatgttgtcataactggaagcacaagaggattagggaaagcacttgctcgggagttccttctttctggagatcgtgttgtaattgcttcacgcagccctgaatcagtccttcagaccatcaacgagcttgaagagaacatacaggagggcttgtcagttgcgaaaaagaaacagagagaaattttgctacatgccaaggttgttggtacatcatgtgatgtttgtaaaccagaagatgtgaaaaagttggtgaactttgccaaggatgagcttggatcaattgatatttggataaataacgctggcacaaacaaaggttttaggccactggtaaacttttcagatgaagatatttctcagattgtctcaacaaacctagttggctctttactgtgcaccagagaagccatgaatgtcatgcaacaccaacaaaagggaggtcacgtatttaacatggatggagcaggttctggaggatcaagtacaccattaacagctgtttatggttcaactaagtgtggccttagacagtttcaagcatcacttctgaaggaaagcagaagatcaaaagttggtgtacacactgcttctcctggaatggtccttacggacctccttttgagcggttcttctctgagaaataaacagatgttcaatttaatatgtgagcttccagaaacagttgcaaggacattggttccgaggatgcgagttgtgaaaggaagtggaaaggcgataaactacttgacaccaccaaggatcttgcttgccttggttactgcatgggttcgccgaggccgatggtttgatgaagagggaagagcagtatatgcagcagaggctgatagaatccgtaattgggctgaaagtcgagcacgcttctctttcacagatgccatggagatgtacacagaaaacacatgggtttctgtgttctcgctctctgtcgtctgcgcattcataattctttccagctcaggtggacctcttccaggcacatga</cdnaseq>

Protein Sequence

<aaseq>MAAAAVVHLSVHGRLRRSPELHARPYHRPSLLRCRAFKQEADNG GEEASSSPPPPTTAEARRRRKGPLYKLKAAIQGLAGSRSAAAEAYGGEYQRAVEKAEE IFFSVATQVGRYVITMMSSGVVLGVGFQLSGGDSQMNTLIWYSWLGGVIIGTMIGANS VLEEHCKAGPRNVVITGSTRGLGKALAREFLLSGDRVVIASRSPESVLQTINELEENI QEGLSVAKKKQREILLHAKVVGTSCDVCKPEDVKKLVNFAKDELGSIDIWINNAGTNK GFRPLVNFSDEDISQIVSTNLVGSLLCTREAMNVMQHQQKGGHVFNMDGAGSGGSSTP LTAVYGSTKCGLRQFQASLLKESRRSKVGVHTASPGMVLTDLLLSGSSLRNKQMFNLI CELPETVARTLVPRMRVVKGSGKAINYLTPPRILLALVTAWVRRGRWFDEEGRAVYAA EADRIRNWAESRARFSFTDAMEMYTENTWVSVFSLSVVCAFIILSSSGGPLPGT</aaseq>

Gene Sequence

<dnaseqindica>87..404#1331..1409#1520..1655#2028..2102#2217..2412#2599..2667#2819..2958#3129..3251#4094..4286#5576..5761#gccctctcctaaaaccaaggaacccaaccccacaaaaaagcgtaggacgccggagtgcgaaatccttatccgctcgcggcgacgccatggccgccgccgcggtggtccacctctccgtgcacggccgcctccgccgctcgccggagctccacgcccggccataccaccgcccgtcgctgctccggtgccgcgcgttcaagcaggaggccgataacggcggggaggaggcttcgtcgtcgccgccgccgccgacgacggccgaggcgcggaggcgcaggaagggcccgctgtacaagctgaaggcggcgattcaggggctcgccgggtcgcggtcggcggccgcggaggcgtacgggggcgagtaccagcgcgccgtcgagaaggccgaggagatcttcttctcggtgagctccattcctgaaccccctcaagctcccccgcaagcgcagtttctctacatgataatatgataatatgtttatggccgattttttcatctgatcgtgtgatctactagtacgactgcctttaattgttgccacgtatcgggaggctcaaccactcaatgcgttagcgagcgctactaccttaatcagctcttgcttagctgcatatgggaattgcacccatcagatgctacagctacaagtgagtttaggcgatctatgttgtttcaatgggtgttaggatccaatacactagctgtggcacaaatcgatgagctgatcaacactaatcagcttgtttcttactagtaatacagtaggctccagttactgtgaaattctgtaatgtcagttccctttatgtttatgtgctggagagcaaattctgcctgcgctaaaattaatcgcaggcctgtgaagcaatttgcctgggcagaggatgcggctcgtagccagaggtgtcattttgtgtagcctttgttgcttttgaaactattttaaacttctttgaaactcgctcttgattaaatttacttcgcccctcatttatatgggcctagattctctggttcttgcatctaccattgtatggggggcatgggctgccaggctcatggttttacatgtccgactgtaagtgcatgcacaggcctgctttatagttcaattgaattgcttcctaggcatgctgattctttgtattgatataaataaaatctccggtatcggctgattctctaacctaagcacatcagtaattttctatttgttgcaaacctgaacagagtggttctgaatttatcactactgagttgtaggatcaactccttttctgaaataggtgttctttttttcaaattgacttatttccttctccttttcaggttgctacgcaagtaggccgatatgttatcactatgatgagcagcggtgttgtacttggagttggatttcagttatcaggttagttacattcatttgatatattgcattgcctttggatacttctgtttttttccctacaatgggcattttcagagtttcagtaatgacctagctacctttctatttaggcggagacagccaaatgaatacactaatttggtatagttggctcgggggagtaattattggcacgatgataggtgcaaacagtgtcctagaggaacactgcaaagctggacctcgcaatgttgtcataactggaaggtaacccattttgcattcttcctttcacatgccatctgaatcttttgctaggaagcatgcatactgtgagtacaggtcaaaggtaataatcaaaactaatgaatttattcctagataggaaatactatttcaccttctattattctctattttcttatttgatgagtggagtataaccataacaatcaccaagtttatacgggttggtgcatagaggagattatgaggtgcagtcatatgaacaaatcattaaagtaacctcataaacatgttaatataaacatgacttctcattgcatcaattgtgagctgatttcttattagtatccatgttctgcaatcaacattgaagttatagtttgattttggcagcacaagaggattagggaaagcacttgctcgggagttccttctttctggagatcgtgttgtaattgcttcacgcaggtggtactcatagacatgtagctcaatgtgtgttgttgttgcatatccatgatattctttttatgaaatgcaatgcgttgtcctagttttaaatatcctattttttgaaggcagccctgaatcagtccttcagaccatcaacgagcttgaagagaacatacaggagggcttgtcagttgcgaaaaagaaacagagagaaattttgctacatgccaaggttgttggtacatcatgtgatgtttgtaaaccagaagatgtgaaaaagttggtgaactttgccaaggatgagcttggatcaattgatatttgggtaaataatttacttttacatatctatccccatcatttattctgcattatttcacggtagggtactcagttggatacttggattgagtgcacaagtttttgtacttataacctttttattttgttctgtactgtggcatcgcagaatgtacttaacatgtgctattcttcttattcttatgtatagataaataacgctggcacaaacaaaggttttaggccactggtaaacttttcagatgaagatatttctcaggtacgttaattatcttcggaaaatcagagtcttttccattctaatagagttcatagaactatattcgtcatgcaacctgacttagttatttcatcttatttttctttctgcttagcctaaacaacattattgtgtccttttctgtttgcagattgtctcaacaaacctagttggctctttactgtgcaccagagaagccatgaatgtcatgcaacaccaacaaaagggaggtcacgtatttaacatggatggagcaggttctggaggatcaagtacaccattaacagctgtgtaagtacctaatgatttcaaatttttaatgctccactgttcgtgtagctcttatactggacagggatattgtcttgtggtttcttcattggctaaaaacgagtataattgtattgatgttgttacttgtgcagtgaaactaaaactgatactattttgcaaacttgcagttatggttcaactaagtgtggccttagacagtttcaagcatcacttctgaaggaaagcagaagatcaaaagttggtgtacacactgcttctcctggaatggtccttacggacctccttttgaggtaacctctgaagttatttagatgcaattattgatgatttgcttgtttagttcattctgaacttcaatatatttattgcttggtgcacatgttgtccaaactccaaaccacactttgtgtgatgatagtaaaacaagataagacttcaagtgcataagaagttttcagtaggatctttatggaaccacacatattggttaatcagaatttcacgctatcttcattttgaatttattttagttaatcaacaatcagaatgtctcctttgttgaatggggaagagtcaaaattttgagatacctcgctgcccaaatcttctttgtttcaatctcttctttctaggatttgatttgtggcaactatttctgtagaatcagcttcacattaattattaagttgcttttgctactacacttctagctctggcttttcctatctgctataatcccgatgacacggtaaactgggtgcgtggcggttaatcagaacctgaaagaattaatgttccattcttgtgcaaatactctgccttgtaaatccagttcaaagttgtgatgttgcacatactttatacttgtaaggcttcatagtttctgtcaatatataaataacttgtgagataacttccagatataattattacaaatgactaatgcactggaaagttctaacatattaatattttttattggtaatactatatacggagaataatatgttttttaacttcaattgatggtgcatgccacttcttccatatttatctggtcagctcttctgttgccacatgcccaactatgcagactgctttagttaacttataatccttctatcttttgcagcggttcttctctgagaaataaacagatgttcaatttaatatgtgagcttccagaaacagttgcaaggacattggttccgaggatgcgagttgtgaaaggaagtggaaaggcgataaactacttgacaccaccaaggatcttgcttgccttggttactgcatgggttcgccgaggccgatggtttgatgaagaggtatgtttcttctctatgcagctagtacttttcagctttaccttttatttcagcaatgccagtatatgaaatatgctgaattcctgcagaagccatgcgtgcaaacatgattgttgttttcattattatgcatcttgcatgcacttttcatgatattgaacctcaagacttttgagctattatgcttctgaaatagtgaaatatacatttctagagaaagagtaccaagctcttctaccgttgcaccaaatgtatatgaaactcattgttgaatataaagaacaatggacatagactattcaaattatgcctgtggtgattttcttgtaaattatgctaaataagcagtattcgttctaagactggatcaaccaggcgagtcagatcataatgaagcttgagaccagtgtccagttctgtcaggtctctacataagtaagagccataaatagggtctgtcttgatggttcagtttccaggttcattatgaccagctcagtccatcacctttactgctagttggccagagctcttctggaaggccttaggctggtcctcccctcaatggcggcttcaaacacctggttccaccatggcttagctcggtccaacagtctcagtgctattgtttgtactgcatgttaaatatgacatagttaattctcacatgtattgctggatctcacctagtccacatgaaatccagcaacagatttaactggagagaatgataggggttttaaaaagcaactgcacccgtcaaatgattgcactctagtaatattttggggctgaaatgggcacaagtatacatattgacgttttttttggtatctcactggtttattggctgtgattttgggaaagaaaatcacctgcaaattttggtaccgtcgaagcttctcaccattagattgacaattattaatggaaaaactgaatgaacacatgtattattttcgcaagatatttaggaaacatgacatttgagaaaaaaaaatgctgagaagtgggtaataatttaattataacgtttgtgttccttcagaatctttcacaatataactgaagaaaagtgctgtatacatcagtgtcttttgtgatggacaatgctccaatcatcctatgtgcaaggttgaaaatcaaacagatgaagtaaaagaatattatattcttacaaatgagagatcagcataccaagcgactttatgcatacttcacagttcataatactttcagtctgatgattaattcatgtgaatgtgtgactgatcataagcacattgcagggaagagcagtatatgcagcagaggctgatagaatccgtaattgggctgaaagtcgagcacgcttctctttcacagatgccatggagatgtacacagaaaacacatgggtttctgtgttctcgctctctgtcgtctgcgcattcataattctttccagctcaggtggacctcttccaggcacatgatcccaggagttgccaaactagatggctacacacaccatttttcttcagtacggggattctattatgtactgatatatgacacacgaaacttatgaaggggggaaattgaacccagaaagcttactgcgtacatacgcccaacggtgagaagcatcagctgccactcaccatttaaggtcaagctaaccatgtgctcagtaaaaatgggtaaatagcatttgttgtgtgggcattccactgtttgtaagctgacttgtaaaaacgtgtatctgagctaaactgagcacgaacagattcgatggacaatgttatctgctgtacatgcatgtagtaatgtagttttgatgactgtaattctctggtcgtcgcttccagttgcacggttgcaccgtatgttgcaaccaccaatagaactgaaagtaagtgagagtaatcaagccagcatctgctatgtatatatatgactcatcagtctgttatatatcacaaggaaagcttcttcaaagctaaaagcaaagctatcagtaagacagt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0227100, RefSeq:Os01g0227100