Difference between revisions of "Os02g0787300"

From RiceWiki
Jump to: navigation, search
(Expression)
(Annotated Information)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
  
 +
===Function===
 
RAI1 gene is up-regulated in suspension cells expressing a constitutively active form of OsRac1. RAI1 encodes a putative basic helix-loop-helix transcription factor. RAI1 is involved in defense responses in rice.RAI1 interacted with OsMAPK3 and OsMAPK6 proteins in vivo and in vitro.  RAI1 was phosphorylated by OsMAPK3/6 and OsMKK4-dd in vitro. RAI1 could be regulated by OsRac1 through an OsMAPK3/6 cascade. RAI1 as the first transcription factor acting downstream of OsRac1.
 
RAI1 gene is up-regulated in suspension cells expressing a constitutively active form of OsRac1. RAI1 encodes a putative basic helix-loop-helix transcription factor. RAI1 is involved in defense responses in rice.RAI1 interacted with OsMAPK3 and OsMAPK6 proteins in vivo and in vitro.  RAI1 was phosphorylated by OsMAPK3/6 and OsMKK4-dd in vitro. RAI1 could be regulated by OsRac1 through an OsMAPK3/6 cascade. RAI1 as the first transcription factor acting downstream of OsRac1.
  

Revision as of 03:25, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

RAI1 gene is up-regulated in suspension cells expressing a constitutively active form of OsRac1. RAI1 encodes a putative basic helix-loop-helix transcription factor. RAI1 is involved in defense responses in rice.RAI1 interacted with OsMAPK3 and OsMAPK6 proteins in vivo and in vitro. RAI1 was phosphorylated by OsMAPK3/6 and OsMKK4-dd in vitro. RAI1 could be regulated by OsRac1 through an OsMAPK3/6 cascade. RAI1 as the first transcription factor acting downstream of OsRac1.

Expression

OsMAPK6 and OsMAPK3 together with OsMKK4-dd can regulate the downstream genes of RAI1 and phosphorylate RAI1 proteins. Therefore,regulation of downstream genes by RAI1 could be accomplished by changes in both its transcription level and post-translationally through an OsMKK4–OsMAPK3/6 cascade.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.


Labs working on this gene

Laboratory of Plant Molecular Genetics, Nara Institute of Science and Technology, 8916-5 Takayama, Ikoma, 630-0192 Japan

Graduate School of Agriculture and Life Sciences, University of Tokyo, Yayoi, Bunkyo, Tokyo, 113-0032 Japan

Agricultural and Veterinary Laboratories, Meiji Seika Kaisha, Kohoku-ku, Yokohama, 222-8567 Japan

Division of Plant Sciences, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki, 305-8602 Japan

References

Sung-Hyun Kim;Tetsuo Oikawa;Junko Kyozuka;Hann Ling Wong;Kenji Umemura;Mitsuko Kishi-Kaboshi;Akira Takahashi;Yoji Kawano;Tsutomu Kawasaki;Ko Shimamoto

 The bHLH Rac Immunity1 (RAI1) Is Activated by OsRac1 via OsMAPK3 and OsMAPK6 in Rice Immunity
 Plant and Cell Physiology, 2012, 53(4): 740-754

Structured Information

Gene Name

Os02g0787300

Description

Similar to MAP kinase kinase

Version

NM_001054876.1 GI:115449122 GeneID:4330957

Length

1879 bp

Definition

Oryza sativa Japonica Group Os02g0787300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:34328931..34330809

Sequence Coding Region

34329593..34330807

Expression

GEO Profiles:Os02g0787300

Genome Context

<gbrowseImage1> name=NC_008395:34328931..34330809 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:34328931..34330809 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ctgcccccgatcggcctcgtcctctccacgccgcgagcccaccagaaaacgcacacgccgacgcgagccaatcaacccgccgcgccgcgcctcgccgccgtcgcgatgcgaccgggcgggccgccgagcttgcgggcggggctgcagcagcagcagcagcagcagccggggacgccggggaggtcgcggcgccggccggatctcacgctgccgctgccgcagcgggacctcacgtcgctcgcggtgccgctgccgctgccgctgccgccgtcgtcggcgccgtcgtcgacgtcgtcgtccgggtcgtcctcgctcggcggcgtgcccaccccgccgaattcggtcggctccgcgccgccggccccgccgccgctgtcggagctggagcgcgtccgccgcatcgggagcggcgcgggcgggacggtgtggatggtgcggcaccgccccacggggcggccgtacgcgctcaaggtgctctacgggaaccacgacgacgccgtgcggcggcagatcacgcgcgagatcgcgatcctccgcaccgccgagcacccggccgtcgtgcggtgccacggcatgtacgagcaggccggcgagctccagatcctgctcgagtacatggacgggggatccctcgagggccgccgcatcgcctccgaggccttcctcgccgacgtcgcgcgccaggtgctctccgggatcgcctacctccaccgccgccacatcgtccaccgcgacatcaagccatccaacctcctcatcgactccggccgccgcgtcaagatcgccgacttcggcgtcggccgcatcctcaaccagaccatggacccctgcaactcctccgtcgggaccatcgcctacatgagccccgagcgcatcaacaccgacctcaacgacggcgcctacgacggctacgccggcgacatctggagcttcggcctgagcattctcgagttctacatgggcaggttccccctcggggagaatctcggcaagcagggagactgggccgccctcatgtgcgcgatttgctactccgactcgccggcgccgccgcccaacgcctcgccggagttcaagagcttcatcagctgctgcctccagaagaacccggcgcggcggccatcggcggcgcagcttctccaacatcggttcgtcgccgggccacagcagcagcagcagccgcagccgcagcccctcgcaccgcctccgtcatga</cdnaseq>

Protein Sequence

<aaseq>LPPIGLVLSTPRAHQKTHTPTRANQPAAPRLAAVAMRPGGPPSL RAGLQQQQQQQPGTPGRSRRRPDLTLPLPQRDLTSLAVPLPLPLPPSSAPSSTSSSGS SSLGGVPTPPNSVGSAPPAPPPLSELERVRRIGSGAGGTVWMVRHRPTGRPYALKVLY GNHDDAVRRQITREIAILRTAEHPAVVRCHGMYEQAGELQILLEYMDGGSLEGRRIAS EAFLADVARQVLSGIAYLHRRHIVHRDIKPSNLLIDSGRRVKIADFGVGRILNQTMDP CNSSVGTIAYMSPERINTDLNDGAYDGYAGDIWSFGLSILEFYMGRFPLGENLGKQGD WAALMCAICYSDSPAPPPNASPEFKSFISCCLQKNPARRPSAAQLLQHRFVAGPQQQQ QPQPQPLAPPPS</aaseq>

Gene Sequence

<dnaseqindica>3..1217#ccctgcccccgatcggcctcgtcctctccacgccgcgagcccaccagaaaacgcacacgccgacgcgagccaatcaacccgccgcgccgcgcctcgccgccgtcgcgatgcgaccgggcgggccgccgagcttgcgggcggggctgcagcagcagcagcagcagcagccggggacgccggggaggtcgcggcgccggccggatctcacgctgccgctgccgcagcgggacctcacgtcgctcgcggtgccgctgccgctgccgctgccgccgtcgtcggcgccgtcgtcgacgtcgtcgtccgggtcgtcctcgctcggcggcgtgcccaccccgccgaattcggtcggctccgcgccgccggccccgccgccgctgtcggagctggagcgcgtccgccgcatcgggagcggcgcgggcgggacggtgtggatggtgcggcaccgccccacggggcggccgtacgcgctcaaggtgctctacgggaaccacgacgacgccgtgcggcggcagatcacgcgcgagatcgcgatcctccgcaccgccgagcacccggccgtcgtgcggtgccacggcatgtacgagcaggccggcgagctccagatcctgctcgagtacatggacgggggatccctcgagggccgccgcatcgcctccgaggccttcctcgccgacgtcgcgcgccaggtgctctccgggatcgcctacctccaccgccgccacatcgtccaccgcgacatcaagccatccaacctcctcatcgactccggccgccgcgtcaagatcgccgacttcggcgtcggccgcatcctcaaccagaccatggacccctgcaactcctccgtcgggaccatcgcctacatgagccccgagcgcatcaacaccgacctcaacgacggcgcctacgacggctacgccggcgacatctggagcttcggcctgagcattctcgagttctacatgggcaggttccccctcggggagaatctcggcaagcagggagactgggccgccctcatgtgcgcgatttgctactccgactcgccggcgccgccgcccaacgcctcgccggagttcaagagcttcatcagctgctgcctccagaagaacccggcgcggcggccatcggcggcgcagcttctccaacatcggttcgtcgccgggccacagcagcagcagcagccgcagccgcagcccctcgcaccgcctccgtcatgatgaattccgatgggattccggcgttgatccggctcggccatggatggacggtggtttggcattgagacgtgggatctaggagtgctcttcctagccattttgggtattcaagccaccaccacaatttagtgatttaccctcatcatcatcccctctcttgtcgctgttgctcctggaattaagctcctctcctctcctccccttcccctcctcaacttttctttaatctcttcttcttcttttttttcttcttcttcttccaattaagttcatgttcttccaaatgatcatcatataatatgggttgttaagaaagcaatttcttcttaattaatttattttctaaaatcatcattggagcagtagaagtagtagtagtagtaggtggtggtgtccatctgctccagttgcaggaggaggaggagaagatggtgacaaaacaacattgtgatgctttgctgtgctggcttcttggattctgcaaattgtggggggtggattggattggattggatggatcatgaatggttggagcaagcaaatcttgaaatgggaaccaaatcaactttattttttcctcctcctcttcctgaatcctgatcctttctctctggtggttttgaggggagaatgatcgaatgaaatcatgaattgctctcttt</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0787300, RefSeq:Os02g0787300