Difference between revisions of "Os01g0172400"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 22: Line 22:
 
==References==
 
==References==
 
Please input cited references here.
 
Please input cited references here.
 +
<references>
 
<ref name=“ref1”>Sang Y, Zhang S, Li W, Huang B, Wang X (2001), Regulation of plant water loss by manipulating the expression of phospholipase Dα. ''Plant J.'' 28, 135-144.</ref>
 
<ref name=“ref1”>Sang Y, Zhang S, Li W, Huang B, Wang X (2001), Regulation of plant water loss by manipulating the expression of phospholipase Dα. ''Plant J.'' 28, 135-144.</ref>
 
<ref name=”ref2”>Pappan, K. Zheng, S. Wang, X (1997) Identification and characterization of a novel phospholipase D that requires polyphosphoinositides and submicromolar calcium for activity in Arabidopsis. ''J. Biol. Chem.'' 272, 7048± 7054.</ref>
 
<ref name=”ref2”>Pappan, K. Zheng, S. Wang, X (1997) Identification and characterization of a novel phospholipase D that requires polyphosphoinositides and submicromolar calcium for activity in Arabidopsis. ''J. Biol. Chem.'' 272, 7048± 7054.</ref>
 
<ref name=”ref3”>Mishra G, Zhang W, Deng F, Wang X (2006) A bifurcating pathway directs abscisic acid effects on stomatal closure and opening in Arabidopsis. ''Science'' 312, 264-266.</ref>
 
<ref name=”ref3”>Mishra G, Zhang W, Deng F, Wang X (2006) A bifurcating pathway directs abscisic acid effects on stomatal closure and opening in Arabidopsis. ''Science'' 312, 264-266.</ref>
 
<ref name=”ref4”>Shen P, Wang R, Jing W, Zhang W (2011) Rice phospholipase Dα is involved in salt tolerance by the mediation of H+-ATPase activity and transcription. ''J. Integr. Plant Biol.'' 53(4), 289 - 299.</ref>
 
<ref name=”ref4”>Shen P, Wang R, Jing W, Zhang W (2011) Rice phospholipase Dα is involved in salt tolerance by the mediation of H+-ATPase activity and transcription. ''J. Integr. Plant Biol.'' 53(4), 289 - 299.</ref>
 
+
<references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 04:15, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. PLDα occupies a critical step in controlling stomatal movements and plant response to water stress.[1] PLDα is the common plant PLD that does not require phosphatidylinositol 4, 5-bisphosphate (PIP2) for activity, when assayed at millimolar concentrations of Ca2+.[2] PLDα1 promotes abscisic acid (ABA)-induced stomatal closure and regulates ABA-inhibited stomatal opening.[3]. OsPLDα1 regulates salt tolerance in rice by activating H+-ATPase activity and transcription in tonoplast and plasma membrane. We also found that OsPLDα1 is important to transiently activate OsCDPK7 transcription in response to NaCl stress.[4]

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. <references> [1] [2] [5] [4] <references>

Structured Information

Gene Name

Os01g0172400

Description

Phospholipase D alpha 1 precursor (EC 3.1.4.4) (PLD alpha 1) (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1)

Version

NM_001048688.1 GI:115434789 GeneID:4327647

Length

4181 bp

Definition

Oryza sativa Japonica Group Os01g0172400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:3723613..3727793

Sequence Coding Region

3723983..3724416,3724895..3726791,3727332..3727439

Expression

GEO Profiles:Os01g0172400

Genome Context

<gbrowseImage1> name=NC_008394:3723613..3727793 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:3723613..3727793 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgcagatgctgctccatgggacgctgcacgccaccatcttcgaggcggcgtcgctctccaacccgcaccgcgccagcggaagcgcccccaagttcatccgcaagtttgtggaggggattgaggacactgtgggtgtcggcaaaggcgccaccaaggtgtattctaccattgatctggagaaagctcgtgtagggcgaactaggatgataaccaatgagcccatcaaccctcgctggtatgagtcgttccacatctattgcgctcatatggcttccaatgtgatcttcactgtcaagattgataaccctattggggcaacgaatattgggagggcttacctgcctgtccaagagcttctcaatggagaggagattgacagatggctcgatatctgtgataataaccgcgagcctgttggtgagagcaagatccatgtgaagcttcagtacttcgatgtttccaaggatcgcaattgggcgaggggtgtccgcagtaccaagtatccaggtgttccttacaccttcttctctcagaggcaagggtgcaaagttaccttgtaccaagatgctcatgtcccagacaacttcattccaaagattccgcttgccgatggcaagaattatgaaccccacagatgctgggaggatatctttgatgctataagcaatgctcaacatttgatttacatcactggctggtctgtatacactgagatcaccttggttagggactccaatcgtccaaaacctggaggggatgtcacccttggggagttgctcaagaagaaggccagtgaaggtgttcgggtcctcatgcttgtgtgggatgacaggacttcagttggtttgctaaagagggatggcttgatggcaacacatgatgaggaaactgaaaattacttccatggctctgacgtgaactgtgttctatgccctcgcaaccctgatgactcaggcagcattgttcaggatctgtcgatctcaactatgtttacacaccatcagaagatagtagttgttgaccatgagttgccaaaccagggctcccaacaaaggaggatagtcagtttcgttggtggccttgatctctgtgatggaaggtatgacactcagtaccattctttgtttaggacactcgacagtacccatcatgatgacttccaccagccaaactttgccactgcatcaatcaaaaagggtggacctagagagccatggcatgatattcactcacggctggaagggccaatcgcatgggatgttctttacaatttcgagcagagatggagaaagcagggtggtaaggatctccttctgcagctcagggatctgtctgacactattattccaccttctcctgttatgtttccagaggacagagaaacatggaatgttcagctatttagatccattgatggtggtgctgcttttgggttccctgatacccctgaggaggctgcaaaagctgggcttgtaagcggaaaggatcaaatcattgacaggagcatccaggatgcatacatacatgccatccggagggcaaagaacttcatctatatagagaaccaatacttccttggaagttcctatgcctggaaacccgagggcatcaagcctgaagacattggtgccctgcatttgattcctaaggagcttgcactgaaagttgtcagtaagattgaagccggggaacggttcactgtttatgttgtggtgccaatgtggcctgagggtgttccagagagtggatctgttcaggcaatcctggactggcaaaggagaacaatggagatgatgtacactgacattacagaggctctccaagccaagggaattgaagcgaaccccaaggactacctcactttcttctgcttgggtaaccgtgaggtgaagcaggctggggaatatcagcctgaagaacaaccagaagctgacactgattacagccgagctcaggaagctaggaggttcatgatctatgtccacaccaaaatgatgatagttgacgatgagtacatcatcatcggttctgcaaacatcaaccagaggtcgatggacggcgctagggactctgagatcgccatgggcgggtaccagccataccatctggcgaccaggcaaccagcccgtggccagatccatggcttccggatggcgctgtggtacgagcacctgggaatgctggatgatgtgttccagcgccccgagagcctggagtgtgtgcagaaggtgaacaggatcgcggagaagtactgggacatgtactccagcgacgacctccagcaggacctccctggccacctcctcagctaccccattggcgtcgccagcgatggtgtggtgactgagctgcccgggatggagtactttcctgacacacgggcccgcgtcctcggcgccaagtcggattacatgccccccatcctcacctcatag</cdnaseq>

Protein Sequence

<aaseq>MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDT VGVGKGATKVYSTIDLEKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKID NPIGATNIGRAYLPVQELLNGEEIDRWLDICDNNREPVGESKIHVKLQYFDVSKDRNW ARGVRSTKYPGVPYTFFSQRQGCKVTLYQDAHVPDNFIPKIPLADGKNYEPHRCWEDI FDAISNAQHLIYITGWSVYTEITLVRDSNRPKPGGDVTLGELLKKKASEGVRVLMLVW DDRTSVGLLKRDGLMATHDEETENYFHGSDVNCVLCPRNPDDSGSIVQDLSISTMFTH HQKIVVVDHELPNQGSQQRRIVSFVGGLDLCDGRYDTQYHSLFRTLDSTHHDDFHQPN FATASIKKGGPREPWHDIHSRLEGPIAWDVLYNFEQRWRKQGGKDLLLQLRDLSDTII PPSPVMFPEDRETWNVQLFRSIDGGAAFGFPDTPEEAAKAGLVSGKDQIIDRSIQDAY IHAIRRAKNFIYIENQYFLGSSYAWKPEGIKPEDIGALHLIPKELALKVVSKIEAGER FTVYVVVPMWPEGVPESGSVQAILDWQRRTMEMMYTDITEALQAKGIEANPKDYLTFF CLGNREVKQAGEYQPEEQPEADTDYSRAQEARRFMIYVHTKMMIVDDEYIIIGSANIN QRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRMALWYEHLGMLDDVFQRPESLE CVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPIGVASDGVVTELPGMEYFPDTRARV LGAKSDYMPPILTS</aaseq>

Gene Sequence

<dnaseqindica>3378..3811#1003..2899#355..462#agtctctcttctcccgcaattttataatctcgctcgatccaatctgctccccttcttcttctactctccccatctcggctctcgccatcgccatcctcctctcccttcccggagaagacgcctccctccgccgatcaccacccggtaagcccagtgtgcttaggctaagcgcactagagcttcttgctcgcttgcttcttctccgctcagatctgcttgcttgcttgcttcgctagaaccctactctgtgctgcgagtgtcgctgcttcgtcttccttcctcaagttcgatctgattgtgtgtgtgggggggcgcaggtagggcgaggagggagccaaatccaaatcagcagccatggcgcagatgctgctccatgggacgctgcacgccaccatcttcgaggcggcgtcgctctccaacccgcaccgcgccagcggaagcgcccccaagttcatccgcaaggttcggacccttctccttaatctactcgtctttgctcttgctctttttcttttttgtccctttcttgtgtgtgcgtttgcatgagcccgaatttgatctgctagtgcacagtacagtcagatacactgaaacgatctggaaattctggattattaggaaaaataaagaggtagtagacaagaattggagatactttctatcaagattggtctattatgcttggccatttcttgtttgacccaagtacttctttgaatctagagtttgctgtgtgtgatgtggtgtgtgtttgtgtcaccaaaaatcttcattagctaaaactgaaattttatttattaactgacctactaaaaatgtagagttctctgtgtgtgatgtgtgcttgtgtcaccaaaaatcttgatttgatagagtttttatttatttattaactgacctactacaaatctattgctgtatgctatgtgtgtctgtatcacctgaaatgcaatgtcttcttctttgttgttcttgatctaacacgtgagctcatgtcaacagtttgtggaggggattgaggacactgtgggtgtcggcaaaggcgccaccaaggtgtattctaccattgatctggagaaagctcgtgtagggcgaactaggatgataaccaatgagcccatcaaccctcgctggtatgagtcgttccacatctattgcgctcatatggcttccaatgtgatcttcactgtcaagattgataaccctattggggcaacgaatattgggagggcttacctgcctgtccaagagcttctcaatggagaggagattgacagatggctcgatatctgtgataataaccgcgagcctgttggtgagagcaagatccatgtgaagcttcagtacttcgatgtttccaaggatcgcaattgggcgaggggtgtccgcagtaccaagtatccaggtgttccttacaccttcttctctcagaggcaagggtgcaaagttaccttgtaccaagatgctcatgtcccagacaacttcattccaaagattccgcttgccgatggcaagaattatgaaccccacagatgctgggaggatatctttgatgctataagcaatgctcaacatttgatttacatcactggctggtctgtatacactgagatcaccttggttagggactccaatcgtccaaaacctggaggggatgtcacccttggggagttgctcaagaagaaggccagtgaaggtgttcgggtcctcatgcttgtgtgggatgacaggacttcagttggtttgctaaagagggatggcttgatggcaacacatgatgaggaaactgaaaattacttccatggctctgacgtgaactgtgttctatgccctcgcaaccctgatgactcaggcagcattgttcaggatctgtcgatctcaactatgtttacacaccatcagaagatagtagttgttgaccatgagttgccaaaccagggctcccaacaaaggaggatagtcagtttcgttggtggccttgatctctgtgatggaaggtatgacactcagtaccattctttgtttaggacactcgacagtacccatcatgatgacttccaccagccaaactttgccactgcatcaatcaaaaagggtggacctagagagccatggcatgatattcactcacggctggaagggccaatcgcatgggatgttctttacaatttcgagcagagatggagaaagcagggtggtaaggatctccttctgcagctcagggatctgtctgacactattattccaccttctcctgttatgtttccagaggacagagaaacatggaatgttcagctatttagatccattgatggtggtgctgcttttgggttccctgatacccctgaggaggctgcaaaagctgggcttgtaagcggaaaggatcaaatcattgacaggagcatccaggatgcatacatacatgccatccggagggcaaagaacttcatctatatagagaaccaatacttccttggaagttcctatgcctggaaacccgagggcatcaagcctgaagacattggtgccctgcatttgattcctaaggagcttgcactgaaagttgtcagtaagattgaagccggggaacggttcactgtttatgttgtggtgccaatgtggcctgagggtgttccagagagtggatctgttcaggcaatcctggactggcaaaggagaacaatggagatgatgtacactgacattacagaggctctccaagccaagggaattgaagcgaaccccaaggactacctcactttcttctgcttgggtaaccgtgaggtgaagcaggctggggaatatcagcctgaagaacaaccagaagctgacactgattacagccgagctcaggaagctaggaggttcatgatctatgtccacaccaaaatgatgataggtaccgagtgagctttatattacatatttgcattcactatgcaatttttgttcatttaaagcatgtcagatgagttacatacttatgtagcatttgttaattttttttaccaagtattgcatttgtctatttattagtttatatgcattgcatatgtcaagctctaagttgaagtcatgcttccctttactcttaaagtaacatctttttagacagaattgtcttctgctctctaaatctgtttctgtttaatacaggtttttatttttaaagaaataatgtcgtattgtaggttatttagctgattttactgttgcattctgtcgttctaaaaagatgaaaatccttttaacaaaagaaataaacaagatcctctaatgatcaagctagtaacttcatctccttattcggtttcttttttctatcaaaaatatacacttattgttcaagctagtaacttcatttcttccattttcagttgacgatgagtacatcatcatcggttctgcaaacatcaaccagaggtcgatggacggcgctagggactctgagatcgccatgggcgggtaccagccataccatctggcgaccaggcaaccagcccgtggccagatccatggcttccggatggcgctgtggtacgagcacctgggaatgctggatgatgtgttccagcgccccgagagcctggagtgtgtgcagaaggtgaacaggatcgcggagaagtactgggacatgtactccagcgacgacctccagcaggacctccctggccacctcctcagctaccccattggcgtcgccagcgatggtgtggtgactgagctgcccgggatggagtactttcctgacacacgggcccgcgtcctcggcgccaagtcggattacatgccccccatcctcacctcatagacgaggaagcactacactacaatctgctggcttctcctgtcagtccttctgtacttcttcagtttggtggcgagatggtatggccgttgttcagaatttcttcagaatagcagttgttacagttgtgaatcataaagtaataagtgcagtatctgtgcatggttgagttgggaagaagatcggggatgcaatgatgcttgtgaagttgtgatgccgtttgtaagatgggaagttgggaactactaagtaattggcatgattgtactttgcactactgtttagcgttgttgatactggttaaccgtgtgttcatctgaacttgattcttgatgcagtttgtggcattaccagtttatcatcgttcttcagg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0172400, RefSeq:Os01g0172400

  1. 1.0 1.1 Sang Y, Zhang S, Li W, Huang B, Wang X (2001), Regulation of plant water loss by manipulating the expression of phospholipase Dα. Plant J. 28, 135-144.
  2. 2.0 2.1 Pappan, K. Zheng, S. Wang, X (1997) Identification and characterization of a novel phospholipase D that requires polyphosphoinositides and submicromolar calcium for activity in Arabidopsis. J. Biol. Chem. 272, 7048± 7054.
  3. Cite error: Invalid <ref> tag; no text was provided for refs named .E2.80.9Cref3.E2.80.9D
  4. 4.0 4.1 Shen P, Wang R, Jing W, Zhang W (2011) Rice phospholipase Dα is involved in salt tolerance by the mediation of H+-ATPase activity and transcription. J. Integr. Plant Biol. 53(4), 289 - 299.
  5. Mishra G, Zhang W, Deng F, Wang X (2006) A bifurcating pathway directs abscisic acid effects on stomatal closure and opening in Arabidopsis. Science 312, 264-266.