Difference between revisions of "Os01g0172400"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
PLDα occupies a critical step in controlling stomatal movements and plant response to water stress.<ref name = "ref1"/> PLDα is the common plant PLD that does not require phosphatidylinositol 4, 5-bisphosphate (PIP2) for activity, when assayed at millimolar concentrations of Ca2+.<ref name="ref2"/> PLDα1 promotes abscisic acid (ABA)-induced stomatal closure and regulates ABA-inhibited stomatal opening.<ref name = "ref1"/><ref name = "ref3"/><ref name = "ref4"/> OsPLDα1 regulates salt tolerance in rice by activating H+-ATPase activity and transcription in tonoplast and plasma membrane. We also found that OsPLDα1 is important to transiently activate ''OsCDPK7'' transcription in response to NaCl stress.<ref name="ref5"/>
+
PLDα occupies a critical step in controlling stomatal movements and plant response to water stress.<ref name = "ref1"/> PLDα is the common plant PLD that does not require phosphatidylinositol 4, 5-bisphosphate (PIP2) for activity, when assayed at millimolar concentrations of Ca2+.<ref name="ref2"/> PLDα1 promotes abscisic acid (ABA)-induced stomatal closure and regulates ABA-inhibited stomatal opening.<ref name = "ref1"/><ref name = "ref3"/><ref name = "ref4"/> OsPLDα1 regulates salt tolerance in rice by activating H+-ATPase activity and transcription in tonoplast and plasma membrane. We also found that OsPLDα1 is important to transiently activate ''OsCDPK7'' transcription in response to NaCl stress.<ref name="ref5"/> There are many PLDs in rice even OsPLDα can be consist of OsPLDα(1, 2, 3, 4, 5, 6, 7, 8 ), different genes own the same function or the partial overlapped function. Venn diagram for differentially expressed PLDs. PLD genes up- and down-regulated (A) under different abiotic stress conditions, (B) under stresses and developmental stages. Different compartments showing genes specific to either a particular stress/developmental stage or more than one stress and/or developmental stage.<ref name="ref6"/>
 +
[[File:FFig2.jpg]]
  
 
===Expression===
 
===Expression===

Revision as of 10:44, 5 June 2014

Please input one-sentence summary here.

Annotated Information

Function

PLDα occupies a critical step in controlling stomatal movements and plant response to water stress.[1] PLDα is the common plant PLD that does not require phosphatidylinositol 4, 5-bisphosphate (PIP2) for activity, when assayed at millimolar concentrations of Ca2+.[2] PLDα1 promotes abscisic acid (ABA)-induced stomatal closure and regulates ABA-inhibited stomatal opening.[1][3][4] OsPLDα1 regulates salt tolerance in rice by activating H+-ATPase activity and transcription in tonoplast and plasma membrane. We also found that OsPLDα1 is important to transiently activate OsCDPK7 transcription in response to NaCl stress.[5] There are many PLDs in rice even OsPLDα can be consist of OsPLDα(1, 2, 3, 4, 5, 6, 7, 8 ), different genes own the same function or the partial overlapped function. Venn diagram for differentially expressed PLDs. PLD genes up- and down-regulated (A) under different abiotic stress conditions, (B) under stresses and developmental stages. Different compartments showing genes specific to either a particular stress/developmental stage or more than one stress and/or developmental stage.[6] FFig2.jpg

Expression

Please input expression information here.

Evolution

Expression of rice PLD gene family has been represented by a heat map. Developmental stages comprising three vegetative stages (L-leaf, R-root and SL-7d-old seeding), six stages of panicle [P1 (0-3 cm), P2 (3-5 cm), P3 (5-10 cm), P4 (10-15 cm), P5 (15-22 cm) and P6 (22-30 cm)] and five stages of seed [S1(0-2 DAP), S2(3-4 DAP), S3(4-10 DAP), S4(11-20 DAP) and S5(21-29 DAP)]. Clustering of the expression profile was done with log transformed average values taking mature leaf as base line. Three stress conditions are denoted as C, Cold stress; D, Drought stress; S, Salt stress and SL, control, seven day old unstressed seedling.[6]

FFig1.jpg

Labs working on this gene

State Key Laboratory of Crop genetics and Germplasm Enhancement; Eastern Cereal and Oilseeds Research Center;

References

  1. 1.0 1.1 Sang Y, Zhang S, Li W, Huang B, Wang X (2001), Regulation of plant water loss by manipulating the expression of phospholipase Dα. Plant J. 28:135-144.
  2. Pappan, K. Zheng, S. Wang, X (1997) Identification and characterization of a novel phospholipase D that requires polyphosphoinositides and submicromolar calcium for activity in Arabidopsis. J. Biol. Chem. 272:7048±7054.
  3. Zhang W, Qin C, Zhao J, Wang X (2004) Phospholipase Dα1-derived phosphatidic acid interacts with ABI1 phosphatase 2C and regulates abscisic acid signaling. Proc. Natl. Acad. Sci. USA. 101:9508 - 9513.
  4. Mishra G, Zhang W, Deng F, Wang X (2006) A bifurcating pathway directs abscisic acid effects on stomatal closure and opening in Arabidopsis. Science 312:264-266.
  5. Shen P, Wang R, Jing W, Zhang W (2011) Rice phospholipase Dα is involved in salt tolerance by the mediation of H+-ATPase activity and transcription. J. Integr. Plant Biol. 53(4):289 - 299.
  6. 6.0 6.1 Singh A, Pandey A, Pandey G et al (2012) Comprehensive expression analysis of rice phospholipase D gene family during abiotic stresses and development. Plant Signaling Behavior. 7(7):847-855.

Structured Information

Gene Name

Os01g0172400

Description

Phospholipase D alpha 1 precursor (EC 3.1.4.4) (PLD alpha 1) (Choline phosphatase 1) (Phosphatidylcholine-hydrolyzing phospholipase D 1)

Version

NM_001048688.1 GI:115434789 GeneID:4327647

Length

4181 bp

Definition

Oryza sativa Japonica Group Os01g0172400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:3723613..3727793

Sequence Coding Region

3723983..3724416,3724895..3726791,3727332..3727439

Expression

GEO Profiles:Os01g0172400

Genome Context

<gbrowseImage1> name=NC_008394:3723613..3727793 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:3723613..3727793 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgcagatgctgctccatgggacgctgcacgccaccatcttcgaggcggcgtcgctctccaacccgcaccgcgccagcggaagcgcccccaagttcatccgcaagtttgtggaggggattgaggacactgtgggtgtcggcaaaggcgccaccaaggtgtattctaccattgatctggagaaagctcgtgtagggcgaactaggatgataaccaatgagcccatcaaccctcgctggtatgagtcgttccacatctattgcgctcatatggcttccaatgtgatcttcactgtcaagattgataaccctattggggcaacgaatattgggagggcttacctgcctgtccaagagcttctcaatggagaggagattgacagatggctcgatatctgtgataataaccgcgagcctgttggtgagagcaagatccatgtgaagcttcagtacttcgatgtttccaaggatcgcaattgggcgaggggtgtccgcagtaccaagtatccaggtgttccttacaccttcttctctcagaggcaagggtgcaaagttaccttgtaccaagatgctcatgtcccagacaacttcattccaaagattccgcttgccgatggcaagaattatgaaccccacagatgctgggaggatatctttgatgctataagcaatgctcaacatttgatttacatcactggctggtctgtatacactgagatcaccttggttagggactccaatcgtccaaaacctggaggggatgtcacccttggggagttgctcaagaagaaggccagtgaaggtgttcgggtcctcatgcttgtgtgggatgacaggacttcagttggtttgctaaagagggatggcttgatggcaacacatgatgaggaaactgaaaattacttccatggctctgacgtgaactgtgttctatgccctcgcaaccctgatgactcaggcagcattgttcaggatctgtcgatctcaactatgtttacacaccatcagaagatagtagttgttgaccatgagttgccaaaccagggctcccaacaaaggaggatagtcagtttcgttggtggccttgatctctgtgatggaaggtatgacactcagtaccattctttgtttaggacactcgacagtacccatcatgatgacttccaccagccaaactttgccactgcatcaatcaaaaagggtggacctagagagccatggcatgatattcactcacggctggaagggccaatcgcatgggatgttctttacaatttcgagcagagatggagaaagcagggtggtaaggatctccttctgcagctcagggatctgtctgacactattattccaccttctcctgttatgtttccagaggacagagaaacatggaatgttcagctatttagatccattgatggtggtgctgcttttgggttccctgatacccctgaggaggctgcaaaagctgggcttgtaagcggaaaggatcaaatcattgacaggagcatccaggatgcatacatacatgccatccggagggcaaagaacttcatctatatagagaaccaatacttccttggaagttcctatgcctggaaacccgagggcatcaagcctgaagacattggtgccctgcatttgattcctaaggagcttgcactgaaagttgtcagtaagattgaagccggggaacggttcactgtttatgttgtggtgccaatgtggcctgagggtgttccagagagtggatctgttcaggcaatcctggactggcaaaggagaacaatggagatgatgtacactgacattacagaggctctccaagccaagggaattgaagcgaaccccaaggactacctcactttcttctgcttgggtaaccgtgaggtgaagcaggctggggaatatcagcctgaagaacaaccagaagctgacactgattacagccgagctcaggaagctaggaggttcatgatctatgtccacaccaaaatgatgatagttgacgatgagtacatcatcatcggttctgcaaacatcaaccagaggtcgatggacggcgctagggactctgagatcgccatgggcgggtaccagccataccatctggcgaccaggcaaccagcccgtggccagatccatggcttccggatggcgctgtggtacgagcacctgggaatgctggatgatgtgttccagcgccccgagagcctggagtgtgtgcagaaggtgaacaggatcgcggagaagtactgggacatgtactccagcgacgacctccagcaggacctccctggccacctcctcagctaccccattggcgtcgccagcgatggtgtggtgactgagctgcccgggatggagtactttcctgacacacgggcccgcgtcctcggcgccaagtcggattacatgccccccatcctcacctcatag</cdnaseq>

Protein Sequence

<aaseq>MAQMLLHGTLHATIFEAASLSNPHRASGSAPKFIRKFVEGIEDT VGVGKGATKVYSTIDLEKARVGRTRMITNEPINPRWYESFHIYCAHMASNVIFTVKID NPIGATNIGRAYLPVQELLNGEEIDRWLDICDNNREPVGESKIHVKLQYFDVSKDRNW ARGVRSTKYPGVPYTFFSQRQGCKVTLYQDAHVPDNFIPKIPLADGKNYEPHRCWEDI FDAISNAQHLIYITGWSVYTEITLVRDSNRPKPGGDVTLGELLKKKASEGVRVLMLVW DDRTSVGLLKRDGLMATHDEETENYFHGSDVNCVLCPRNPDDSGSIVQDLSISTMFTH HQKIVVVDHELPNQGSQQRRIVSFVGGLDLCDGRYDTQYHSLFRTLDSTHHDDFHQPN FATASIKKGGPREPWHDIHSRLEGPIAWDVLYNFEQRWRKQGGKDLLLQLRDLSDTII PPSPVMFPEDRETWNVQLFRSIDGGAAFGFPDTPEEAAKAGLVSGKDQIIDRSIQDAY IHAIRRAKNFIYIENQYFLGSSYAWKPEGIKPEDIGALHLIPKELALKVVSKIEAGER FTVYVVVPMWPEGVPESGSVQAILDWQRRTMEMMYTDITEALQAKGIEANPKDYLTFF CLGNREVKQAGEYQPEEQPEADTDYSRAQEARRFMIYVHTKMMIVDDEYIIIGSANIN QRSMDGARDSEIAMGGYQPYHLATRQPARGQIHGFRMALWYEHLGMLDDVFQRPESLE CVQKVNRIAEKYWDMYSSDDLQQDLPGHLLSYPIGVASDGVVTELPGMEYFPDTRARV LGAKSDYMPPILTS</aaseq>

Gene Sequence

<dnaseqindica>3378..3811#1003..2899#355..462#agtctctcttctcccgcaattttataatctcgctcgatccaatctgctccccttcttcttctactctccccatctcggctctcgccatcgccatcctcctctcccttcccggagaagacgcctccctccgccgatcaccacccggtaagcccagtgtgcttaggctaagcgcactagagcttcttgctcgcttgcttcttctccgctcagatctgcttgcttgcttgcttcgctagaaccctactctgtgctgcgagtgtcgctgcttcgtcttccttcctcaagttcgatctgattgtgtgtgtgggggggcgcaggtagggcgaggagggagccaaatccaaatcagcagccatggcgcagatgctgctccatgggacgctgcacgccaccatcttcgaggcggcgtcgctctccaacccgcaccgcgccagcggaagcgcccccaagttcatccgcaaggttcggacccttctccttaatctactcgtctttgctcttgctctttttcttttttgtccctttcttgtgtgtgcgtttgcatgagcccgaatttgatctgctagtgcacagtacagtcagatacactgaaacgatctggaaattctggattattaggaaaaataaagaggtagtagacaagaattggagatactttctatcaagattggtctattatgcttggccatttcttgtttgacccaagtacttctttgaatctagagtttgctgtgtgtgatgtggtgtgtgtttgtgtcaccaaaaatcttcattagctaaaactgaaattttatttattaactgacctactaaaaatgtagagttctctgtgtgtgatgtgtgcttgtgtcaccaaaaatcttgatttgatagagtttttatttatttattaactgacctactacaaatctattgctgtatgctatgtgtgtctgtatcacctgaaatgcaatgtcttcttctttgttgttcttgatctaacacgtgagctcatgtcaacagtttgtggaggggattgaggacactgtgggtgtcggcaaaggcgccaccaaggtgtattctaccattgatctggagaaagctcgtgtagggcgaactaggatgataaccaatgagcccatcaaccctcgctggtatgagtcgttccacatctattgcgctcatatggcttccaatgtgatcttcactgtcaagattgataaccctattggggcaacgaatattgggagggcttacctgcctgtccaagagcttctcaatggagaggagattgacagatggctcgatatctgtgataataaccgcgagcctgttggtgagagcaagatccatgtgaagcttcagtacttcgatgtttccaaggatcgcaattgggcgaggggtgtccgcagtaccaagtatccaggtgttccttacaccttcttctctcagaggcaagggtgcaaagttaccttgtaccaagatgctcatgtcccagacaacttcattccaaagattccgcttgccgatggcaagaattatgaaccccacagatgctgggaggatatctttgatgctataagcaatgctcaacatttgatttacatcactggctggtctgtatacactgagatcaccttggttagggactccaatcgtccaaaacctggaggggatgtcacccttggggagttgctcaagaagaaggccagtgaaggtgttcgggtcctcatgcttgtgtgggatgacaggacttcagttggtttgctaaagagggatggcttgatggcaacacatgatgaggaaactgaaaattacttccatggctctgacgtgaactgtgttctatgccctcgcaaccctgatgactcaggcagcattgttcaggatctgtcgatctcaactatgtttacacaccatcagaagatagtagttgttgaccatgagttgccaaaccagggctcccaacaaaggaggatagtcagtttcgttggtggccttgatctctgtgatggaaggtatgacactcagtaccattctttgtttaggacactcgacagtacccatcatgatgacttccaccagccaaactttgccactgcatcaatcaaaaagggtggacctagagagccatggcatgatattcactcacggctggaagggccaatcgcatgggatgttctttacaatttcgagcagagatggagaaagcagggtggtaaggatctccttctgcagctcagggatctgtctgacactattattccaccttctcctgttatgtttccagaggacagagaaacatggaatgttcagctatttagatccattgatggtggtgctgcttttgggttccctgatacccctgaggaggctgcaaaagctgggcttgtaagcggaaaggatcaaatcattgacaggagcatccaggatgcatacatacatgccatccggagggcaaagaacttcatctatatagagaaccaatacttccttggaagttcctatgcctggaaacccgagggcatcaagcctgaagacattggtgccctgcatttgattcctaaggagcttgcactgaaagttgtcagtaagattgaagccggggaacggttcactgtttatgttgtggtgccaatgtggcctgagggtgttccagagagtggatctgttcaggcaatcctggactggcaaaggagaacaatggagatgatgtacactgacattacagaggctctccaagccaagggaattgaagcgaaccccaaggactacctcactttcttctgcttgggtaaccgtgaggtgaagcaggctggggaatatcagcctgaagaacaaccagaagctgacactgattacagccgagctcaggaagctaggaggttcatgatctatgtccacaccaaaatgatgataggtaccgagtgagctttatattacatatttgcattcactatgcaatttttgttcatttaaagcatgtcagatgagttacatacttatgtagcatttgttaattttttttaccaagtattgcatttgtctatttattagtttatatgcattgcatatgtcaagctctaagttgaagtcatgcttccctttactcttaaagtaacatctttttagacagaattgtcttctgctctctaaatctgtttctgtttaatacaggtttttatttttaaagaaataatgtcgtattgtaggttatttagctgattttactgttgcattctgtcgttctaaaaagatgaaaatccttttaacaaaagaaataaacaagatcctctaatgatcaagctagtaacttcatctccttattcggtttcttttttctatcaaaaatatacacttattgttcaagctagtaacttcatttcttccattttcagttgacgatgagtacatcatcatcggttctgcaaacatcaaccagaggtcgatggacggcgctagggactctgagatcgccatgggcgggtaccagccataccatctggcgaccaggcaaccagcccgtggccagatccatggcttccggatggcgctgtggtacgagcacctgggaatgctggatgatgtgttccagcgccccgagagcctggagtgtgtgcagaaggtgaacaggatcgcggagaagtactgggacatgtactccagcgacgacctccagcaggacctccctggccacctcctcagctaccccattggcgtcgccagcgatggtgtggtgactgagctgcccgggatggagtactttcctgacacacgggcccgcgtcctcggcgccaagtcggattacatgccccccatcctcacctcatagacgaggaagcactacactacaatctgctggcttctcctgtcagtccttctgtacttcttcagtttggtggcgagatggtatggccgttgttcagaatttcttcagaatagcagttgttacagttgtgaatcataaagtaataagtgcagtatctgtgcatggttgagttgggaagaagatcggggatgcaatgatgcttgtgaagttgtgatgccgtttgtaagatgggaagttgggaactactaagtaattggcatgattgtactttgcactactgtttagcgttgttgatactggttaaccgtgtgttcatctgaacttgattcttgatgcagtttgtggcattaccagtttatcatcgttcttcagg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0172400, RefSeq:Os01g0172400