Difference between revisions of "Atp8"
(→Annotated Information) |
|||
| Line 13: | Line 13: | ||
You can also add sub-section(s) at will. | You can also add sub-section(s) at will. | ||
| + | ATP synthase F0 subunit 8 | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
Revision as of 14:54, 19 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will. ATP synthase F0 subunit 8
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
atp8 |
|---|---|
| Description |
Subunit 8 of the F0 sector of mitochondrial inner membrane F1-F0 ATP synthase, encoded on the mitochondrial genome |
| Version |
GeneID:807862 |
| Length |
207 bp |
| Definition |
Oryza sativa Japonica Group atp8, Mitochondrion gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Mitochondrion:7784..7990 |
| Sequence Coding Region |
7784..7990 |
| Genome Context |
<gbrowseImage1> name=NC_011033:7784..7990 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage1> |
| Gene Structure (RNA Editing) |
<gbrowseImage2> name=NC_011033:263141..263365 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MPQLDTSKWFITILSVMFTLFVLFQVKLSNYNFPLDLSSKSEDLKKNKTPWELKWTKIYLPHLLPLQ</aaseq> |
| Gene Sequence |
<dnaseqindica>1..225#ATGCCCCAACTAAATACCGCCGTATGACCCACCATAATTACCCCCATACTCCTGACACTATTTCTCGTCA CCCAACTAAAAATATTAAATTCAAATTACCATCTACCCCCCTCACCAAAACCCATAAAAATAAAAAACTA CAATAAACCCTGAGAACCAAAATGAACGAAAATCTATTCGCTTCATTCGCTGCCCCCACAATCCTAG</dnaseqindica> |
| External Link(s) |