Difference between revisions of "OrfB"
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | + | Please input function information here. | |
| + | |||
| + | ===Expression=== | ||
| + | Please input expression information here. | ||
| + | |||
| + | ===Evolution=== | ||
| + | Please input evolution information here. | ||
| + | |||
| + | You can also add sub-section(s) at will. | ||
| + | |||
| + | ==Labs working on this gene== | ||
| + | Please input related labs here. | ||
| + | |||
| + | ==References== | ||
| + | Please input cited references here. | ||
{{Mitochondrion| | {{Mitochondrion| | ||
GeneName = orfB| | GeneName = orfB| | ||
Revision as of 10:22, 6 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
| Gene Name |
orfB |
|---|---|
| Description |
ORFB protein |
| Version |
GeneID:6450152 |
| Length |
468 bp |
| Definition |
Oryza sativa Japonica Group orfB, Mitochondrion gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Mitochondrion:53424..53891 |
| Sequence Coding Region |
53424..53891 |
| Genome Context |
<gbrowseImage3> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage3> |
| Gene Structure (RNA Editing) |
<gbrowseImage2> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MPQLDKLTYFSQFFWLCLFFFSFYILLLNNNNGILGISRILKLRNQLLSHRGNKIRFKDPKNLEDILRKGFSTGLSYMYSSLSEVSQWCKTVDYLGKRRKITLISDFGEISGSRGMERQILYLISKSSYNTSSSRITCWKKIMLTHVLHGQGSII</aaseq> |
| Gene Sequence |
<dnaseqindica>1..468#atgcctcaacttgataaattgacttatttctcacaattcttctggttatgccttttcctctttagtttttatattctcttattaaataataataatggaatacttggaattagcagaattctcaaactacggaaccaactgctttcgcaccgggggaacaagatccgtttcaaggaccctaagaatttggaagatatctcgagaaaaggttttagcaccggtctctcatatatgtactccagtttatccgaagtatcccaatggtgtaagaccgtcgactatttgggaaaaaggaggaaaatcactctgatctcagatttcggagaaataagtggctcacgaggaatggagagacagattctctatttgatctcgaagtcctcatataacacttcttccagtcggatcacttgttggaaaaaaataatgctcacacatgttccacacgggcaaggaagcataatctaa</dnaseqindica> |
| External Link(s) |
