Difference between revisions of "Os01g0159600"
| Line 15: | Line 15: | ||
==Labs working on this gene== | ==Labs working on this gene== | ||
Please input related labs here. | Please input related labs here. | ||
| − | + | 1.Institute of Plant and Microbial Biology, Academia Sinica, Taipei, 11529, Taiwan, ROC. | |
| + | 2.Laboratory of Plant Physiology, Wageningen University, Wageningen, PO Box 658, NL-6700 AR, The Netherlands. | ||
==References== | ==References== | ||
Please input cited references here. | Please input cited references here. | ||
Revision as of 15:40, 5 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Please input function information here.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here. 1.Institute of Plant and Microbial Biology, Academia Sinica, Taipei, 11529, Taiwan, ROC. 2.Laboratory of Plant Physiology, Wageningen University, Wageningen, PO Box 658, NL-6700 AR, The Netherlands.
References
Please input cited references here. Ming-Der Shih; Lin-Tzu Huang; Fu-Jin Wei; Ming-Tsung Wu; Folkert A. Hoekstra; Yue-Ie C. Hsing (2010). OsLEA1a, a new Em-like protein of cereal plants. Plant and Cell Physiology, 51(12): 2132-2144.
Structured Information
| Gene Name |
Os01g0159600 |
|---|---|
| Description |
Small hydrophilic plant seed protein family protein |
| Version |
NM_001048621.2 GI:297596143 GeneID:4324064 |
| Length |
975 bp |
| Definition |
Oryza sativa Japonica Group Os01g0159600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:3123351..3124325 |
| Sequence Coding Region |
3123807..3123939,3124052..3124200 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:3123351..3124325 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:3123351..3124325 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgcagcaggcggagaaggcggcggagctgcaggacccggagatccgggcggagctggaccggcgcgcccgcgacgacggcaagaccgtcatcaagagcggcaccggcggcaagagcctcgacgcccaggagcgcctcgccgaagggcgtaagaagggagggctgagccgcacgacggagtccggcaaggagcgcgccgacgacgacaccggcgccgtgctcatcgagcccgacgacaagatgctcaaggaggccaaaaagaacctgggccgcaagtga</cdnaseq> |
| Protein Sequence |
<aaseq>MAQQAEKAAELQDPEIRAELDRRARDDGKTVIKSGTGGKSLDAQ ERLAEGRKKGGLSRTTESGKERADDDTGAVLIEPDDKMLKEAKKNLGRK</aaseq> |
| Gene Sequence |
<dnaseqindica>387..519#126..274#atcgatccatcgctagcttatctcaatctcgccacgaggaaataaagcctagcgcatattagccgttggttggtttagtatacgtacgtagggtagcttagcttagagcacgtacgtacgcatcgatggcgcagcaggcggagaaggcggcggagctgcaggacccggagatccgggcggagctggaccggcgcgcccgcgacgacggcaagaccgtcatcaagagcggcaccggcggcaagagcctcgacgcccaggagcgcctcgccgaaggcccgtgtcctttttatgtttcttctctcttttgtgctatatcttttacacgttctgatcgatttgatgtgtacgtacgtttatattggcgtaatagtgtatacgtgtgcagggcgtaagaagggagggctgagccgcacgacggagtccggcaaggagcgcgccgacgacgacaccggcgccgtgctcatcgagcccgacgacaagatgctcaaggaggccaaaaagaacctgggccgcaagtgagacgtacgtgcactagcgtgctggtgtgttgtggttgctcgatcatatagtagtgtactagtgtgtgcatttccttggtgtatccatgtgcatgcatgcatggcaggcgtacgtattagtattactctacgtgacgtgtaagctatgctggctacaaaattttggtccctgcaggattatattgtagccatatgtatgttagtatgtatgtacgtgttcttcacgtactgccctagctactagcaagtcgatctagctatatcgtgtgtgtgtacgtatattgtgatcgatgtacgaagctgctgctttctacatcctggctacaaatgtaattgtgtttgtgtgtctccgtacgctacgtttctgtgtgtctgtagccatgcattgtcctcttcaaggctccaatgttatataacaataagtggttgatttctactgatgaaagcttagtttatc</dnaseqindica> |
| External Link(s) |