Difference between revisions of "Os03g0309200"

From RiceWiki
Jump to: navigation, search
Line 4: Line 4:
 
===Function===
 
===Function===
 
Please input function information here.
 
Please input function information here.
 
+
PhyA phytochrome-mediated regulation of rice Hd1 florigen Hd3a expression and critical day length. Hd3a expression inhibition PhyB mediated inhibition of rice is long-day flowering main reason. First overexpression Hd1, under short-day conditions is needed to delay flowering in rice phyB participation, indicating light regulation Hd1 Hd3a transcription regulation; secondly, just to extend the length of a single day can reduce Hd3a expression, and the extent corresponding to the length of day; last , in the presence of light conditions, Hd1 Hd1 protein levels in plants overexpressing not changed. These results also show that the expression of phyB-mediated inhibition of rice Hd3a molecular mechanisms critical day length is an integral component[5]
 +
These findings indicate that phytochromes contribute to multiple steps in the control of internode elongation, such as the expression of the GA biosynthesis gene OsGA3ox2, ACO1 expression, and the onset of internode elongation.[6]
 +
PhyB total leaf area and by controlling the density of stomata of rice drought tolerance, phyB reason drought, double the total area and lower leaf transpiration per unit area of the blade itself lead to a decrease in water loss[1]
 +
Phytochrome GA oxidase inhibiting the expression of genes GA20ox. Rice seedlings, phytochrome-mediated inhibition of the biosynthesis of GA, and cryptochrome cry1 activity involved in the induction of GA inactivation, the accumulation of these independent role in reducing the levels of active gibberellin light. With the results of different studies dicots, independent and coordinated regulation of active gibberellin content of rice in different light receptor pathway.[3]
 
===Expression===
 
===Expression===
 
Please input expression information here.
 
Please input expression information here.
 
+
We have isolated phytochrome B (phyB) and phyC mutants from rice (Oryza sativa) and have produced all combinations of double mutants. Seedlings of phyB and phyB phyC mutants exhibited a partial loss of sensitivity to continuous red light (Rc) but still showed significant deetiolation responses. The responses to Rc were completely canceled in phyA phyB double mutants. These results indicate that phyA and phyB act in a highly redundant manner to control deetiolation under Rc. Under continuous far-red light (FRc), phyA mutants showed partially impaired deetiolation, and phyA phyC double mutants showed no significant residual phytochrome responses, indicating that not only phyA but also phyC is involved in the photoperception of FRc in rice. Interestingly, the phyB phyC double mutant displayed clear R/FR reversibility in the pulse irradiation experiments, indicating that both phyA and phyB can mediate the low-fluence response for gene expression. Rice is a short-day plant, and we found that mutation in either phyB or phyC caused moderate early flowering under the long-day photoperiod, while monogenic phyA mutation had little effect on the flowering time. The phyA mutation, however, in combination with phyB or phyC mutation caused dramatic early flowering.[9]
 
===Evolution===
 
===Evolution===
 
Please input evolution information here.
 
Please input evolution information here.
 
+
Phytochromes are believed to be solely responsible for red and far-red light perception, but this has never been definitively tested. To directly address this hypothesis, a phytochrome triple mutant (phyAphyBphyC) was generated in rice (Oryza sativa L. cv. Nipponbare) and its responses to red and far-red light were monitored. Since rice only has three phytochrome genes (PHYA, PHYB and PHYC), this mutant is completely lacking any phytochrome. Rice seedlings grown in the dark develop long coleoptiles while undergoing regular circumnutation. The phytochrome triple mutants also show this characteristic skotomorphogenesis, even under continuous red or far-red light. The morphology of the triple mutant seedlings grown under red or far-red light appears completely the same as etiolated seedlings, and they show no expression of the light-induced genes. This is direct evidence demonstrating that phytochromes are the sole photoreceptors for perceiving red and far-red light, at least during rice seedling establishment. Furthermore, the shape of the triple mutant plants was dramatically altered. Most remarkably, triple mutants extend their internodes even during the vegetative growth stage, which is a time during which wild-type rice plants never elongate their internodes. The triple mutants also flowered very early under long day conditions and set very few seeds due to incomplete male sterility. These data indicate that phytochromes play an important role in maximizing photosynthetic abilities during the vegetative growth stage in rice.[8]
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
  

Revision as of 10:15, 6 June 2014

Please input one-sentence summary here. Rice phytochrome is the feeling of the red / far-red light receptors only.Rice only three phytochrome genes, PHYA, PHYB and PHYC. Hd3a expression inhibition PhyB mediated inhibition of rice is long-day flowering main reason.

Annotated Information

Function

Please input function information here. PhyA phytochrome-mediated regulation of rice Hd1 florigen Hd3a expression and critical day length. Hd3a expression inhibition PhyB mediated inhibition of rice is long-day flowering main reason. First overexpression Hd1, under short-day conditions is needed to delay flowering in rice phyB participation, indicating light regulation Hd1 Hd3a transcription regulation; secondly, just to extend the length of a single day can reduce Hd3a expression, and the extent corresponding to the length of day; last , in the presence of light conditions, Hd1 Hd1 protein levels in plants overexpressing not changed. These results also show that the expression of phyB-mediated inhibition of rice Hd3a molecular mechanisms critical day length is an integral component[5] These findings indicate that phytochromes contribute to multiple steps in the control of internode elongation, such as the expression of the GA biosynthesis gene OsGA3ox2, ACO1 expression, and the onset of internode elongation.[6] PhyB total leaf area and by controlling the density of stomata of rice drought tolerance, phyB reason drought, double the total area and lower leaf transpiration per unit area of the blade itself lead to a decrease in water loss[1] Phytochrome GA oxidase inhibiting the expression of genes GA20ox. Rice seedlings, phytochrome-mediated inhibition of the biosynthesis of GA, and cryptochrome cry1 activity involved in the induction of GA inactivation, the accumulation of these independent role in reducing the levels of active gibberellin light. With the results of different studies dicots, independent and coordinated regulation of active gibberellin content of rice in different light receptor pathway.[3]

Expression

Please input expression information here. We have isolated phytochrome B (phyB) and phyC mutants from rice (Oryza sativa) and have produced all combinations of double mutants. Seedlings of phyB and phyB phyC mutants exhibited a partial loss of sensitivity to continuous red light (Rc) but still showed significant deetiolation responses. The responses to Rc were completely canceled in phyA phyB double mutants. These results indicate that phyA and phyB act in a highly redundant manner to control deetiolation under Rc. Under continuous far-red light (FRc), phyA mutants showed partially impaired deetiolation, and phyA phyC double mutants showed no significant residual phytochrome responses, indicating that not only phyA but also phyC is involved in the photoperception of FRc in rice. Interestingly, the phyB phyC double mutant displayed clear R/FR reversibility in the pulse irradiation experiments, indicating that both phyA and phyB can mediate the low-fluence response for gene expression. Rice is a short-day plant, and we found that mutation in either phyB or phyC caused moderate early flowering under the long-day photoperiod, while monogenic phyA mutation had little effect on the flowering time. The phyA mutation, however, in combination with phyB or phyC mutation caused dramatic early flowering.[9]

Evolution

Please input evolution information here. Phytochromes are believed to be solely responsible for red and far-red light perception, but this has never been definitively tested. To directly address this hypothesis, a phytochrome triple mutant (phyAphyBphyC) was generated in rice (Oryza sativa L. cv. Nipponbare) and its responses to red and far-red light were monitored. Since rice only has three phytochrome genes (PHYA, PHYB and PHYC), this mutant is completely lacking any phytochrome. Rice seedlings grown in the dark develop long coleoptiles while undergoing regular circumnutation. The phytochrome triple mutants also show this characteristic skotomorphogenesis, even under continuous red or far-red light. The morphology of the triple mutant seedlings grown under red or far-red light appears completely the same as etiolated seedlings, and they show no expression of the light-induced genes. This is direct evidence demonstrating that phytochromes are the sole photoreceptors for perceiving red and far-red light, at least during rice seedling establishment. Furthermore, the shape of the triple mutant plants was dramatically altered. Most remarkably, triple mutants extend their internodes even during the vegetative growth stage, which is a time during which wild-type rice plants never elongate their internodes. The triple mutants also flowered very early under long day conditions and set very few seeds due to incomplete male sterility. These data indicate that phytochromes play an important role in maximizing photosynthetic abilities during the vegetative growth stage in rice.[8] You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0309200

Description

Similar to Phytochrome B

Version

NM_001056445.2 GI:297600819 GeneID:4332623

Length

7990 bp

Definition

Oryza sativa Japonica Group Os03g0309200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:11070815..11078804

Sequence Coding Region

11070927..11070960,11071182..11073185,11073584..11074391,11075509..11075802,11078140..11078362

Expression

GEO Profiles:Os03g0309200

Genome Context

<gbrowseImage1> name=NC_008396:11070815..11078804 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:11070815..11078804 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>ggtgaggtgaggcgaggaaaaaatcggacgcacccgcagtacaccctggacgcgcgcctccacgccgtgttcgagcagtcgggcgcgtcgggccgcagcttcgactacacgcagtcgctgcgtgcgtcgcccaccccgtcctccgagcagcagatcgccgcctacctctcccgcatccagcgcggcgggcacatacagcccttcggctgcacgctcgccgtcgccgacgactcctccttccgcctcctcgcctactccgagaacaccgccgacctgctcgacctgtcgccccaccactccgtcccctcgctcgactcctccgcggtgcctccccccgtctcgctcggcgcagacgcgcgcctccttttcgccccctcgtccgccgtcctcctcgagcgcgccttcgccgcgcgcgagatctcgctgctcaacccgctctggatccactccagggtctcctctaaacccttctacgccatcctccaccgcatcgatgtcggcgtcgtcatcgacctcgagcccgcccgcaccgaggatcctgcactctccatcgctggcgcagtccagtctcagaagctcgcggtccgtgccatctcccgcctccaggcgcttcccggcggtgacgtcaagctcctttgcgacaccgttgttgagtatgttagagagctcacaggttatgaccgcgttatggtgtacaggttccatgaggatgagcatggagaagtcgttgccgagagccggcgcaataaccttgagccctacatcgggttgcattatcctgctacagatatcccacaggcatcacgcttcctgttccggcagaaccgtgtgcggatgattgctgattgccatgctgcgccggtgagggtcatccaggatcctgcactaacacagccgctgtgcttggttgggtccacgctgcgttcgccgcatggttgccatgcgcagtatatggcgaacatgggttccattgcatctcttgttatggcagtgatcattagtagtggtggggatgatgatcataacatttcacggggcagcatcccgtcggcgatgaagttgtgggggttggtagtatgccaccacacatctccacggtgcatccctttcccactacggtatgcatgcgagttcctcatgcaagcctttgggttgcagctcaacatggagttgcagcttgcacaccaactgtcagagaaacacattctgcggacgcagacactgctgtgtgatatgctactccgggattcaccaactggcattgtcacacaaagccccagcatcatggaccttgtgaagtgtgatggtgctgctctgtattaccatgggaagtactaccctcttggtgtcactcccacagaagttcagattaaggacatcatcgagtggttgactatgtgccatggagactccacagggctcagcacagatagccttgctgatgcaggctaccctggtgctgctgcactaggagatgcagtgagtggaatggcggtagcatatatcacgccaagtgattatttgttttggttccggtcacacacagctaaggagataaagtggggtggtgcaaagcatcatccagaggataaggatgatggacaacgaatgcatccacgatcatcgttcaaggcatttcttgaagttgtgaagagtaggagcttaccatgggagaatgcggagatggatgcaatacattccttgcagctcatattgcgggactctttcagagattctgcagagggcacaagtaactcaaaagccatagtgaatggccaggttcagcttggggagctagaattacggggaatagatgagcttagctcggtagcaagggagatggttcggttgatcgagacagcaacagtacccatctttgcagtagatactgatggatgtataaatggttggaatgcaaaggttgctgagctgacaggcctctctgttgaggaagcaatgggcaaatcattggtaaatgatctcatcttcaaggaatctgaggaaacagtaaacaagctactctcacgagctttaagaggtgatgaagacaaaaatgtagagataaagttgaagacattcgggccagaacaatctaaaggaccaatattcgttattgtgaatgcttgttctagcagggattacactaaaaatattgttggtgtttgttttgttggccaagatgtcacaggacaaaaggtggtcatggataaatttatcaacatacaaggggattacaaggctatcgtacacaaccctaatcctctcatacccccaatatttgcttcagatgagaatacttgttgttcggagtggaacacagcaatggaaaaactcacaggatggtcaagaggggaagttgttggtaagcttctggtcggtgaggtctttggtaattgttgtcgactcaagggcccagatgcattaacgaaattcatgattgtcctacacaacgctataggaggacaggattgtgaaaagttccccttttcattttttgacaagaatgggaaatacgtgcaggccttattgactgcaaacacgaggagcagaatggatggtgaggccataggagccttctgtttcttgcagattgcaagtcctgaattacagcaagcctttgagattcagagacaccatgaaaagaagtgttatgcaaggatgaaggaattggcttacatttaccaggaaataaagaatcctctcaacggtatccgatttacaaactcgttattggagatgactgatctaaaggatgaccagaggcagtttcttgaaaccagcactgcttgtgagaaacagatgtccaaaattgttaaggatgctagcctccaaagtattgaggatggctctttggtgcttgagaaaggtgaattttcactaggtagtgttatgaatgctgttgtcagccaagtgatgatacagttgagagaaagagatttacaacttattcgagatatccctgatgaaattaaagaagcctcagcatatggtgaccaatatagaattcaacaagttttatgtgactttttgctaagcatggtgaggtttgctccagctgaaaatggctgggtggagatacaggtcagaccaaatataaaacaaaattctgatggaacagacacaatgcttttcctcttcaggtttgcctgtcctggcgaaggccttcccccagagattgttcaagacatgtttagtaactcccgctggacaacccaagagggtattggcctaagcatatgcaggaagatcctaaaattgatgggtggcgaggtccaatatataagggagtcggagcggagtttcttccatatcgtacttgagctgccccagcctcagcaagcagcaagtagggggacaagctga</cdnaseq>

Protein Sequence

<aaseq>GEVRRGKNRTHPQYTLDARLHAVFEQSGASGRSFDYTQSLRASP TPSSEQQIAAYLSRIQRGGHIQPFGCTLAVADDSSFRLLAYSENTADLLDLSPHHSVP SLDSSAVPPPVSLGADARLLFAPSSAVLLERAFAAREISLLNPLWIHSRVSSKPFYAI LHRIDVGVVIDLEPARTEDPALSIAGAVQSQKLAVRAISRLQALPGGDVKLLCDTVVE YVRELTGYDRVMVYRFHEDEHGEVVAESRRNNLEPYIGLHYPATDIPQASRFLFRQNR VRMIADCHAAPVRVIQDPALTQPLCLVGSTLRSPHGCHAQYMANMGSIASLVMAVIIS SGGDDDHNISRGSIPSAMKLWGLVVCHHTSPRCIPFPLRYACEFLMQAFGLQLNMELQ LAHQLSEKHILRTQTLLCDMLLRDSPTGIVTQSPSIMDLVKCDGAALYYHGKYYPLGV TPTEVQIKDIIEWLTMCHGDSTGLSTDSLADAGYPGAAALGDAVSGMAVAYITPSDYL FWFRSHTAKEIKWGGAKHHPEDKDDGQRMHPRSSFKAFLEVVKSRSLPWENAEMDAIH SLQLILRDSFRDSAEGTSNSKAIVNGQVQLGELELRGIDELSSVAREMVRLIETATVP IFAVDTDGCINGWNAKVAELTGLSVEEAMGKSLVNDLIFKESEETVNKLLSRALRGDE DKNVEIKLKTFGPEQSKGPIFVIVNACSSRDYTKNIVGVCFVGQDVTGQKVVMDKFIN IQGDYKAIVHNPNPLIPPIFASDENTCCSEWNTAMEKLTGWSRGEVVGKLLVGEVFGN CCRLKGPDALTKFMIVLHNAIGGQDCEKFPFSFFDKNGKYVQALLTANTRSRMDGEAI GAFCFLQIASPELQQAFEIQRHHEKKCYARMKELAYIYQEIKNPLNGIRFTNSLLEMT DLKDDQRQFLETSTACEKQMSKIVKDASLQSIEDGSLVLEKGEFSLGSVMNAVVSQVM IQLRERDLQLIRDIPDEIKEASAYGDQYRIQQVLCDFLLSMVRFAPAENGWVEIQVRP NIKQNSDGTDTMLFLFRFACPGEGLPPEIVQDMFSNSRWTTQEGIGLSICRKILKLMG GEVQYIRESERSFFHIVLELPQPQQAASRGTS</aaseq>

Gene Sequence

<dnaseqindica>113..146#368..2371#2770..3577#4695..4988#7326..7548#gcaatcccactctcatctccctcagttactgccttgctccccaaccccaggagcaagcacaagtccactgcgtgcgtgcgagcgatgactccgataaccgcaggggcggtgaggtgaggtgaggcgaggaaaaaatcggacgcacccgcctaatccggaccaatccaccgcatcggcgccatggcctcgggtagccgcgccacgcccacgcgctccccctcctccgcgcggcccgcggcgccgcggcaccagcaccaccactcgcagtcctcgggcgggagcacgtcccgcgcgggagggggtggcgggggcgggggagggggagggggcggcgcggccgccgcggagtcggtgtccaaggccgtggcgcagtacaccctggacgcgcgcctccacgccgtgttcgagcagtcgggcgcgtcgggccgcagcttcgactacacgcagtcgctgcgtgcgtcgcccaccccgtcctccgagcagcagatcgccgcctacctctcccgcatccagcgcggcgggcacatacagcccttcggctgcacgctcgccgtcgccgacgactcctccttccgcctcctcgcctactccgagaacaccgccgacctgctcgacctgtcgccccaccactccgtcccctcgctcgactcctccgcggtgcctccccccgtctcgctcggcgcagacgcgcgcctccttttcgccccctcgtccgccgtcctcctcgagcgcgccttcgccgcgcgcgagatctcgctgctcaacccgctctggatccactccagggtctcctctaaacccttctacgccatcctccaccgcatcgatgtcggcgtcgtcatcgacctcgagcccgcccgcaccgaggatcctgcactctccatcgctggcgcagtccagtctcagaagctcgcggtccgtgccatctcccgcctccaggcgcttcccggcggtgacgtcaagctcctttgcgacaccgttgttgagtatgttagagagctcacaggttatgaccgcgttatggtgtacaggttccatgaggatgagcatggagaagtcgttgccgagagccggcgcaataaccttgagccctacatcgggttgcattatcctgctacagatatcccacaggcatcacgcttcctgttccggcagaaccgtgtgcggatgattgctgattgccatgctgcgccggtgagggtcatccaggatcctgcactaacacagccgctgtgcttggttgggtccacgctgcgttcgccgcatggttgccatgcgcagtatatggcgaacatgggttccattgcatctcttgttatggcagtgatcattagtagtggtggggatgatgatcataacatttcacggggcagcatcccgtcggcgatgaagttgtgggggttggtagtatgccaccacacatctccacggtgcatccctttcccactacggtatgcatgcgagttcctcatgcaagcctttgggttgcagctcaacatggagttgcagcttgcacaccaactgtcagagaaacacattctgcggacgcagacactgctgtgtgatatgctactccgggattcaccaactggcattgtcacacaaagccccagcatcatggaccttgtgaagtgtgatggtgctgctctgtattaccatgggaagtactaccctcttggtgtcactcccacagaagttcagattaaggacatcatcgagtggttgactatgtgccatggagactccacagggctcagcacagatagccttgctgatgcaggctaccctggtgctgctgcactaggagatgcagtgagtggaatggcggtagcatatatcacgccaagtgattatttgttttggttccggtcacacacagctaaggagataaagtggggtggtgcaaagcatcatccagaggataaggatgatggacaacgaatgcatccacgatcatcgttcaaggcatttcttgaagttgtgaagagtaggagcttaccatgggagaatgcggagatggatgcaatacattccttgcagctcatattgcgggactctttcagagattctgcagagggcacaagtaactcaaaagccatagtgaatggccaggttcagcttggggagctagaattacggggaatagatgagcttagctcggtagcaagggagatggttcggttgatcgagacagcaacagtacccatctttgcagtagatactgatggatgtataaatggttggaatgcaaaggttgctgagctgacaggcctctctgttgaggaagcaatgggcaaatcattggtaaatgatctcatcttcaaggaatctgaggaaacagtaaacaagctactctcacgagctttaagaggtacctctcttgtcatgctaattggttgttcttgcctttcatgttttcttttgcgaatatacacaatactgtttactcgatattctttaattacttggatccctaacctgtaatgctaatttggttcctcttgcctttcatgtttcatatggatagtgcacacaatactgtttactcgatattctttaatgacttgacatttagacacatttgataatttacaacagtgcccaaaactgacaaagtatattgagctcattcagtaggtacatgtaaggctggaatactagttatattattctaaattacttattcaatacaccacagtgagtttatgttttcactaaggggaagtggtaggactgggttcatgatttgttaatttgttgctcatgcaggtgatgaagacaaaaatgtagagataaagttgaagacattcgggccagaacaatctaaaggaccaatattcgttattgtgaatgcttgttctagcagggattacactaaaaatattgttggtgtttgttttgttggccaagatgtcacaggacaaaaggtggtcatggataaatttatcaacatacaaggggattacaaggctatcgtacacaaccctaatcctctcatacccccaatatttgcttcagatgagaatacttgttgttcggagtggaacacagcaatggaaaaactcacaggatggtcaagaggggaagttgttggtaagcttctggtcggtgaggtctttggtaattgttgtcgactcaagggcccagatgcattaacgaaattcatgattgtcctacacaacgctataggaggacaggattgtgaaaagttccccttttcattttttgacaagaatgggaaatacgtgcaggccttattgactgcaaacacgaggagcagaatggatggtgaggccataggagccttctgtttcttgcagattgcaagtcctgaattacagcaagcctttgagattcagagacaccatgaaaagaagtgttatgcaaggatgaaggaattggcttacatttaccaggaaataaagaatcctctcaacggtatccgatttacaaactcgttattggagatgactgatctaaaggatgaccagaggcagtttcttgaaaccagcactgcttgtgagaaacagatgtccaaaattgttaaggatgctagcctccaaagtattgaggatgggttagtattctgaacttacctttttctttaactttaatgaatactgatccacactaatgtctctgtgtttgggataacatctgagaatggcatatgatatcccgttgtgctcttgaaaaaatgtatgttttgtgatcctctcctttctttaccttgtgctaagactaggtgttgtttggtgtttcagttggcactaaccgttaacctaagcatggatggaaaataaggaattagagaagtccgtcagactgacagctctggttcactgtattcatttatctgaaaagttctcttgccatgtaaattttatccttttttagattaatgcctgtattctgtgcatgtgggccttttatgggaatttagtttactgtcagaacccttcttgtcattgcagaaatgaactaaaactagttgcccaagtgtagatatcaagcataaaattcatgctaatatctatattgctagtatcctaagtacattgccgtcctcaacagcttaaccttttggccaaaatggttgttgcatgaaagtcgacatcaagcagcttactctaaaaatgccattgccaccctttactcttgtttcataaatatggtaactatttcttgtaaatgctgctgtacactttacttgtttgaaattttggagatcattctggtttccttgcatcacttgatcaattcctctcagctgcatttattgacaatgaatgtgcaatgcttttatcctgaggaagtcactactccctctggttccataattcttggtgttttggacaatgacacggtctccgaaatatatctttgagtatatttttctattataatacttcctccgtcccaaattaagttaatatagtacgggatgtgacatatcctagtagtaccaaagtccaagcatagcctaatctagcatagttccaaataggaactcatggctctgtgatgtatttttcttgtgtcatttacttggtgtaatttcattctaggtagaagcattgtgtgactttttcgtgtgctgagacatttgaactcactgctaaatttgacgccttattagtattttaacaaatgattagctgaaagcttatttgttttttgtgtttattaagcagctctttggtgcttgagaaaggtgaattttcactaggtagtgttatgaatgctgttgtcagccaagtgatgatacagttgagagaaagagatttacaacttattcgagatatccctgatgaaattaaagaagcctcagcatatggtgaccaatatagaattcaacaagttttatgtgactttttgctaagcatggtgaggtttgctccagctgaaaatggctgggtggagatacaggtcagaccaaatataaaacaaaattctgatggaacagacacaatgcttttcctcttcaggttagctatttatcttcattttcaataccagaaggcaatacatattctcacgcaggaatttcttgtgttgaatttggtagaggacaagttaaatatttggttaaatttatattcgttggtcatatttgctgtagcactctaggtaatatttgtgtttatcctgaactattgatgctctacctacagacactacaaaaaatagattatcctaaataagatctcctacatatcaaacatatgtattatccctgtacatatctgatagactgaagaccccacctatttaagtataaatatatgcaaaatatatgtgtcatgggttggctggtcactctctttgagtaaatttggaagataataaaatacacttggtttattttctttgagtaagtgacataaaacgctaggttttggggccttagtaacacaaacccccaagttttgcaatttgtgtcaaagaacccaaggctttgaggcaaaatgctttataaagccctagatttatatacaaaacacttacacgccattataatgaaccaaatttcaactgtatacttacatagatacgcattcctaatcctaccgtgtagtctatttccttccccactctcctactgaatgaatacacaatggcaaactccagttacaaagaccagggccgtctccaggatatgggggccccagaacaaaatgcaaattgagaccctaaatttttaaaaaataatgtgtcattttcagttattatataactttaatatgtgttatttcgtatgatatttagtacttcctccgtttcaggttataagactttctagcattgcccacattcataaatatgttaatgaatctagacatatatatatgtcaagattcattaacatatatatgaatatgggcaatgctagaaagtcttataacctaaaacggaggtagtaatatattttcaaatattaatggtacaagagtaaaggtagtactaaccttatgttccagtgtaaagcatcatctgctgaggatttgaggacttcctgttttataaaaagggagaagacgttcacattacttttgattcgataattatcaatccaatggaatgatggatcattcaaaatactgtaacagtgtaacttcattagccttgattcaaattagtaatcagtaaattatcgattccgagtaccaactagagctaggcctcgcagcctcgtcgccgctcgccgttcccattgctccgcttggcaacatcggcgttgtgctgcctgctgccgtgaggcgtaatgctgtcgctgccgcctgctgtgctgcacacacgcagcaagtcgcgtctctccacgagtgaacactaaaaagtaaacagttaagacggagcgacatatgtcttccgcctgggcacctagcgtagctcctgatctagggccaggctgcaggcctactccgaggcgggggcccccaaaaatagggggccttgtgcggccgccgtgctcgcacatggccttagacggccctgacaaagacatgttaactgggtacataaatgcacaaacagtcatgccgtcaacatcgatacttgtcgagtaggcggctaatgcacaaacagtcaaggtactactgaaaaaactaccacatactattttgtacagctattatgcataaattccatagctagctggttgatgttgacacaaaatggggttctgtgaaacatttgggcccaaaacctgggttagttgaaataaattgcaaaatctgggttcttatgttactagtaccacactaccactaaaactgcagatttatgaaatctaccttatgtataattaagcctcctaggctcttaggaactgctgctaacaaaatagtagagatatgataggattttgacaataggtaacaaatactaagaacaaggaaactagagatggtatgatcaattaaacttggtccttatctgttgaagatggtgttggaactttatcttagtgatgccagctaggaagccctcatacctgctgctaggtgctacagtacgctactgttcaccggtgtccatggctagcacaccctcatggttccccccccctccaaaaaaaaaaaagattagttattacagcatgtaccttcgttgtaatggtgttgtaaataataaaatatcaacaattatttcttggtgttggagtattaaacgtgtgacactggtcaccaaggtgaatgatgcttaaaatttggaattttttaattgtctgcactagttcgtgttgttacttatagtatagagaacctaatgactcggcagggaggaccacaaactgatcgcttaccatctatctggttctgcaggtttgcctgtcctggcgaaggccttcccccagagattgttcaagacatgtttagtaactcccgctggacaacccaagagggtattggcctaagcatatgcaggaagatcctaaaattgatgggtggcgaggtccaatatataagggagtcggagcggagtttcttccatatcgtacttgagctgccccagcctcagcaagcagcaagtagggggacaagctgatatggtgtatgctcgtcgctaacctcgcataactattcggtcaaccaggtgacctgggatcttctgatggagaacccagtttatgagagttccagaaaccaacatttcgtccactctgatgaagcacatctgaactttggaacggcatcggtgattctcggtgtcgaggtggtccctccagtctcctgattcctggcatgcccgactgtaagttcagctttggacgatgttgttctattagagttctatggcggcaagcaatgcacactgacggtcatgtaactcgtagcataggcccactaccacttggttgaagtacatatatgttctaaaagctgccatgtatataacatcggttatatatgtactacgtgcataaggagagctgtgcagctcccagggtggtattttgtagggcttcccaagcctatgacatcttatt</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0309200, RefSeq:Os03g0309200