|
|
| Line 29: |
Line 29: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| + | [[Category:Genes]][[Category:Oryza Sativa Japonica Group]][[Category:Japonica Chromosome 2]] |
| − | GeneName = Os02g0726700|
| |
| − | Description = Basic helix-loop-helix dimerisation region bHLH domain containing protein|
| |
| − | Version = NM_001054528.1 GI:115448426 GeneID:4330593|
| |
| − | Length = 1936 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os02g0726700, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| − | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 2|Chromosome 2]]|
| |
| − | AP = Chromosome 2:31120147..31122082|
| |
| − | CDS = 31120423..31120583,31120671..31120848,31120955..31120993,31121072..31121167,31121247..31121314<br>,31121504..31121617,31121704..31122082|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008395:31120147..31122082
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008395:31120147..31122082
| |
| − | source=RiceChromosome02
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggagatccgcagatcactgaggccactggacctggccaagcagcgcggccgcagcagcggcaatggcacggcggcggggagtgccgtcgacggcgcgtcgccggcaggttcggactcggaggagcacgtgctaccgggcggcgtcgggacgttcagcatcaggcacgcgtccggtactccgtcgagagaagaggccggtagccatggcggcgtcaggaggagtgcgttcgcatttgcacctgcgcttcatggcgccaggatggagaatgcacatgaaacaggaggaagatctgggagtagggctcaccgtgcgccgtcgacgatgtggcaagattctgccattgatcaaagatccataggccagacaccatatgaagcaacaagagcagagggaagaagtagcgccagcagcgccgatcagggacccagcactccgagatcaaagcattcagcaactgagcagagaaggaggaccaagataaatgacaggcttgaaatacttcgtgaactcctgccacacactgatcagaagagagacaaagcttctttcctttcggaggttattgaatacataaggtttttgcaagagaaagtccaaaagtatgaggaagccgatccagaaaggaatcacgaggattccaaatccatgccatgggcaaaagtctactatagatcatgctggagaaacacaaagaacaccagtcaagtccagggggaagatttgtcaccatccacacaggacatgaacaacgaacagtacggtcccaagcacatatcggcagcacaacctgctctcttcaacacacagagtgtaaccagtacaaccaccagttcctcccacatggcaacaggcacaccacaaaatttggaaaagaacagcacacccagcaatcagccaccatggctgagcatgtcaacaatgcgccaagagtctgaaccaggcaacaaaatgccgaacaagcatgagaaacagacccttcacgatgaaaaccatagtatttctagcgcttactctcaagggtctgttccttaa</cdnaseq>|
| |
| − | AA = <aaseq>MEIRRSLRPLDLAKQRGRSSGNGTAAGSAVDGASPAGSDSEEHV LPGGVGTFSIRHASGTPSREEAGSHGGVRRSAFAFAPALHGARMENAHETGGRSGSRA HRAPSTMWQDSAIDQRSIGQTPYEATRAEGRSSASSADQGPSTPRSKHSATEQRRRTK INDRLEILRELLPHTDQKRDKASFLSEVIEYIRFLQEKVQKYEEADPERNHEDSKSMP WAKVYYRSCWRNTKNTSQVQGEDLSPSTQDMNNEQYGPKHISAAQPALFNTQSVTSTT TSSSHMATGTPQNLEKNSTPSNQPPWLSMSTMRQESEPGNKMPNKHEKQTLHDENHSI SSAYSQGSVP</aaseq>|
| |
| − | DNA = <dnaseqindica>1500..1660#1235..1412#1090..1128#916..1011#769..836#466..579#1..379#atggagatccgcagatcactgaggccactggacctggccaagcagcgcggccgcagcagcggcaatggcacggcggcggggagtgccgtcgacggcgcgtcgccggcaggttcggactcggaggagcacgtgctaccgggcggcgtcgggacgttcagcatcaggcacgcgtccggtactccgtcgagagaagaggccggtagccatggcggcgtcaggaggagtgcgttcgcatttgcacctgcgcttcatggcgccaggatggagaatgcacatgaaacaggaggaagatctgggagtagggctcaccgtgcgccgtcgacgatgtggcaagattctgccattgatcaaagatccataggccagacaccatatgaaggttagtaccgcagttgtattgttgattctctagtctgtcacttcaattcaggcactgatggatttgatatatacatgtgcactcagcaacaagagcagagggaagaagtagcgccagcagcgccgatcagggacccagcactccgagatcaaagcattcagcaactgagcagagaaggaggaccaagataaatgacaggcaagctagtagaggtcaaacaccattttgaattattttctgcagagcaggaacaaaccaaccatgaagacgtagctagatagctcaacaagatatcatattagcagcatttaattccaagacaatttcatataagtatatggtgcaagaaatgtgttctaaaatgcaattcttcatgctctccttcaggcttgaaatacttcgtgaactcctgccacacactgatcagaagagagacaaagcttctttcctttcggaggtaaacagaatatcaattttggcactgtagtcagcaggctatattgcaatttctcccttgtgaagcattttgtttgcaggttattgaatacataaggtttttgcaagagaaagtccaaaagtatgaggaagccgatccagaaaggaatcacgaggattccaaatccatgccatgggtactatcatagccatgttagcatgttcatgacataattgtgcaacagtattcaccctctatttttttttcttggtaggcaaaagtctactatagatcatgctggagaaacacaaaggtaattccgtaaaataaaaacagcaactgaaagcgaatgcacaattcatcataatcatataccaatgatatgtacccatccttgtttcttgttcatggtctcacagaacaccagtcaagtccagggggaagatttgtcaccatccacacaggacatgaacaacgaacagtacggtcccaagcacatatcggcagcacaacctgctctcttcaacacacagagtgtaaccagtacaaccaccagttcctcccacatggcaacaggcacaccacaaaatttggaaagtaagtccatttcttatcacctttcaacagtcagaattcttgtaattaagaactagatccactaactttaatgtcttttaaacgcagagaacagcacacccagcaatcagccaccatggctgagcatgtcaacaatgcgccaagagtctgaaccaggcaacaaaatgccgaacaagcatgagaaacagacccttcacgatgaaaaccatagtatttctagcgcttactctcaagggtctgttccttaaccatttgttacttcaagactaaagttagcacaatatgtaactaacaggatactacttcaatttgcaacagattattcaacagattgacagaagctcttaaaaagtcaggactagatccatctcaagctaatatagctgtagagatcaacctggccaaacgagcaagagataatactagtgacaactcaaaggtatagagctttacaaagttgatttattcatgatgtttgaacatatagatcgtctgcttaataattattttgtacctttgtcctg</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001054528.1 RefSeq:Os02g0726700]|
| |
| − | }}
| |
| − | [[Category:Genes]] | |
| − | [[Category:Japonica mRNA]]
| |
| − | [[Category:Oryza Sativa Japonica Group]] | |
| − | [[Category:Japonica Genes]] | |
| − | [[Category:Japonica Chromosome 2]]
| |
| − | [[Category:Chromosome 2]]
| |
Revision as of 06:48, 14 May 2015
OsbHLH133 is a regulator of iron distribution between roots and shoots in Oryza sativa.
Annotated Information
Function
OsbHLH133 was found to be induced by Fe-deficiency conditions in Oryza sativa. Insertional inactivation of OsbHLH133 (bhlh133) resulted in growth retardation, with enhanced Fe concentration seen in shoots, and reduced Fe concentration in roots. Overexpression of OsbHLH133 had the opposite effect, that is resulted in an enhanced Fe concentration in roots and reduced Fe concentration in shoots and also in xylem sap. Microarray analysis showed that some of the genes encoding Fe-related functions were up-regulated under Fe-sufficient conditions, in bhlh133 mutant plants compared to wild-type plants. Significant differential expression of a number of signalling pathways, including calcium signalling, was also seen in bhlh133 plants compared to wild-type plants, independent of Fe conditions.
1.RT-PCR analyses showed that the transcript abundance of OsbHLH133 was significantly induced by Fe deficiency in rice roots and slightly in leaves.
2.Expression of OsbHLH133 in the root of overexpression (OE) and mutant (bhlh133) plants in Fe-sufficient (+Fe) and -deficient (−Fe) conditions. As expected, no transcripts encoding OsbHLH133 could be detected in the bhlh133 mutant plants and over 100-fold induction is seen in the OE plants.
3.Growth performance of overexpression (OE) and mutant (bhlh133) plants in Fe-sufficient (+Fe) and -deficient (−Fe) conditions. Seedlings were germinated and grown on the culture solution supplied with 100 µM (+Fe) or 2 µM EDTA-Fe (II) (−Fe) for 3 weeks. (a) Growth performance and shoot length of mutant plants under Fe-sufficient (+Fe) and -deficient (−Fe) conditions. (b) Growth performance and shoot length of OE lines under Fe-sufficient (+Fe) and -deficient (−Fe) conditions. (c) SPAD value of the youngest and fully expanded leaves. Bar = 3 cm. Data shown as the mean ± SD (n = 5). Significance (P < 0.05) of differences in (longer/shorter or higher/lower) compared to WT is indicated by an asterisk.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
