Difference between revisions of "Os06g0211200"

From RiceWiki
Jump to: navigation, search
Line 1: Line 1:
Os06g0211200, encoding a gene named OsAREB1(an ABRE-binding protein responding to ABA and glucosemay), function as a positive regulator in drought/heat stresses response, but a negative regulator in flowering time in Arabidopsis.
+
OsAREB1,an ABRE-binding protein responding to ABA and glucosemay, may function as a positive regulator in drought/heat stresses response, but a negative regulator in flowering time in Arabidopsis.
  
 
==Annotated Information==
 
==Annotated Information==
Line 41: Line 41:
 
β-galactosidase activity was performed. Compared to the negative control, the relative β-galactosidase activity of the transformants was about four (Fig. 1C), which revealed there’s a distinct enhancement for β-galactosidase activity.
 
β-galactosidase activity was performed. Compared to the negative control, the relative β-galactosidase activity of the transformants was about four (Fig. 1C), which revealed there’s a distinct enhancement for β-galactosidase activity.
  
[[File:Example.jpg]]
 
  
  
Line 54: Line 53:
  
 
==References==
 
==References==
  Lu, G. J., Gao, C. X., Zheng, X. N. and Han, B. (2009)  
+
  Lu, G. J., Gao, C. X., Zheng, X. N. and Han, B. (2009) Identification of OsbZIP72 as a positive regulator of ABA  
Identification of OsbZIP72 as a positive regulator of ABA  
+
response and drought tolerance in rice.  Planta  229, 605-615.
response and drought tolerance in rice.  Planta  229,  
 
605-615.
 
  
Jin XF1, Xiong AS, Peng RH, Liu JG, Gao F, Chen JM, Yao QH. (2010)  
+
Jin XF1, Xiong AS, Peng RH, Liu JG, Gao F, Chen JM, Yao QH. (2010) OsAREB1, an ABRE-binding protein responding to ABA and glucose, has multiple functions in Arabidopsis.BMB Rep 43(1):34-9.
OsAREB1, an ABRE-binding protein responding to ABA and glucose, has multiple functions in Arabidopsis.
 
BMB Rep 43(1):34-9.
 
  
 
==Structured Information==
 
==Structured Information==

Revision as of 14:09, 6 June 2014

OsAREB1,an ABRE-binding protein responding to ABA and glucosemay, may function as a positive regulator in drought/heat stresses response, but a negative regulator in flowering time in Arabidopsis.

Annotated Information

Function

Firstly, Overexpression of OsAREB1alters seedling sensitivity to ABA and glucose. Secondly, Enhanced tolerance of 35S-OsAREB1plants to drought and heat. Thirdly, OsAREB1 delay the flowering time.


Expression

Expression patterns of the OsAREB1 gene under various environmental stresses and hormones were analyzed by RT-PCR. OsAREB1 gene was induced within 1 or 2 h under 100 μM ABA and 15% PEG 6,000 treatments, and maintained the expression level for at least 8 hours. It’s expression was induced by heat within 1 h, and rapidly reached the top expression level within 2 h, then declined to initial level. OsAREB1 was not induced by KT, MeJA, NaCl and cold .These results indicated that OsAREB1was induced by exogenous ABA, water stress and heat. This result was consistent with the report of Lu et al. (17).


Evolution

Please input evolution information here.

Extending Knowledge

Binding activity

OsAREB1 has ABRE-binding activity in yeast Blast result indicated that OsAREB1 belongs to ABF subfamily. Most members of this subfamily can bind to the ABRE cis-element with a core sequence ACGTGCC. Yeast one-hybrid system was used to determine the DNA-binding activity of OsAREB1 with ABRE element. The entire coding region of OsAREB1 was fused to the GAL4 transcription active domain (TA). The construct was transformed into yeast (EGY48) harboring ABRE sequence fused upstream of a lacZreporter gene, and the growth status of transformants was observed. Yeast cells harboring pPC86 and G222 could grow on SD medium lacking Trp, while cells only with G222 could not grow on the selection medium (Fig. 1A). The colony-lift filter assay suggested that OsAREB1 can bind to the ABRE cis-element. Shown as Fig. 1B, when the colony grew on X-gal containing plate, only cells with pPC86-OsAREB1 and G222 turned blue, cells only with G222 or with both G222 and pPC86 did not turn blue. This result indicated that only OsAREB1 can bind to the ABRE cis-element and then active the expression of lacZ gene. Further, quantificational analysis for β-galactosidase activity was performed. Compared to the negative control, the relative β-galactosidase activity of the transformants was about four (Fig. 1C), which revealed there’s a distinct enhancement for β-galactosidase activity.


You can also add sub-section(s) at will.

Labs working on this gene

1 Biotechnology Research Institute, Shanghai Academy of Agricultural Sciences, Shanghai, 2 College of Life Science and Technology, Yangzhou University, Jiangsu, PR China

References

Lu, G. J., Gao, C. X., Zheng, X. N. and Han, B. (2009) Identification of OsbZIP72 as a positive regulator of ABA 

response and drought tolerance in rice. Planta 229, 605-615.

Jin XF1, Xiong AS, Peng RH, Liu JG, Gao F, Chen JM, Yao QH. (2010) OsAREB1, an ABRE-binding protein responding to ABA and glucose, has multiple functions in Arabidopsis.BMB Rep 43(1):34-9.

Structured Information

Gene Name

Os06g0211200

Description

Similar to Abscisic acid responsive elements-binding factor (ABA-responsive element binding protein 1) (AREB1)

Version

NM_001063653.1 GI:115467037 GeneID:4340462

Length

4829 bp

Definition

Oryza sativa Japonica Group Os06g0211200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:5676158..5680986

Sequence Coding Region

5676361..5677152,5677846..5677917,5678514..5678543,5680499..5680575,5680665..5680668

Expression

GEO Profiles:Os06g0211200

Genome Context

<gbrowseImage1> name=NC_008399:5676158..5680986 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:5676158..5680986 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagttgccggcggatgggagcgcgctggcgaggcaggggtcgatctactcgctgacgttcgacgagttccagagcgcgctgggaagcgccgagaaggatttcgggtcgatgaacatggatgagctgctgcgcaacatctggacggcggaggagtcgcaggccatagcgccggcggcggcggctgcttcggcggcggcggtggttggggacgcgcagcagcagcagcagccgatccagaggcaggggtcgctgacgctgccacgcacgctgagccagaagacggtggacgaggtgtggcgcgacatcatgggcttgggcggcagcgacgacgaagaccccgcggcggcggcggctgcggcggcgcccgcgcagcggcagccgacgctgggggagatgacgctggaggagttcctggtgcgggccggcgtcgtgcgggaggacatggggcagaccatcgtgctgccgccgcaggcgcaggcgttgttccccgggagcaatgtggtcgccccggccatgcagctcgccaacgggatgctgcctggtgtcgtcggcgtcgcccccggcgccgccgccgcgatgacggtggcggcgccggccacgccggtggtgctgaacgggctggggaaggtggagggcggggatctctcgtcgctctcgccggtgccttacccattcgacaccgcgctcagggtgaggaagggccctaccgtcgagaaggtggtggagaggcggcagaggcggatgatcaagaacagggagtccgctgctaggtctcgcgcgcggaagcaggcttatataatggagttggaagctgaggtggcaaaactgaaggaacagaaggctgaattgcagaaaaagcaggtggaaatgatacagaagcaaaatgatgaggtcatggagagaatcactcagcaacttggaccaaaggcaaagagattttgcctccgacgaacactgactggtccatgctga</cdnaseq>

Protein Sequence

<aaseq>MELPADGSALARQGSIYSLTFDEFQSALGSAEKDFGSMNMDELL RNIWTAEESQAIAPAAAAASAAAVVGDAQQQQQPIQRQGSLTLPRTLSQKTVDEVWRD IMGLGGSDDEDPAAAAAAAAPAQRQPTLGEMTLEEFLVRAGVVREDMGQTIVLPPQAQ ALFPGSNVVAPAMQLANGMLPGVVGVAPGAAAAMTVAAPATPVVLNGLGKVEGGDLSS LSPVPYPFDTALRVRKGPTVEKVVERRQRRMIKNRESAARSRARKQAYIMELEAEVAK LKEQKAELQKKQVEMIQKQNDEVMERITQQLGPKAKRFCLRRTLTGPC</aaseq>

Gene Sequence

<dnaseqindica>204..995#1689..1760#2357..2386#4342..4418#4508..4511#gattaaacctgatttccccttgctaattcgggccatcgcatcactcccccaactaatcacactcctctcttctccgcttcctcttctcgtatatttataaccccacttcccttttcttcctctttcttctcatcttggtttcttcctagtttcgggagaggattttagtgagggatttgaaggattttgaggtgggagaggagatggagttgccggcggatgggagcgcgctggcgaggcaggggtcgatctactcgctgacgttcgacgagttccagagcgcgctgggaagcgccgagaaggatttcgggtcgatgaacatggatgagctgctgcgcaacatctggacggcggaggagtcgcaggccatagcgccggcggcggcggctgcttcggcggcggcggtggttggggacgcgcagcagcagcagcagccgatccagaggcaggggtcgctgacgctgccacgcacgctgagccagaagacggtggacgaggtgtggcgcgacatcatgggcttgggcggcagcgacgacgaagaccccgcggcggcggcggctgcggcggcgcccgcgcagcggcagccgacgctgggggagatgacgctggaggagttcctggtgcgggccggcgtcgtgcgggaggacatggggcagaccatcgtgctgccgccgcaggcgcaggcgttgttccccgggagcaatgtggtcgccccggccatgcagctcgccaacgggatgctgcctggtgtcgtcggcgtcgcccccggcgccgccgccgcgatgacggtggcggcgccggccacgccggtggtgctgaacgggctggggaaggtggagggcggggatctctcgtcgctctcgccggtgccttacccattcgacaccgcgctcagggtgaggaagggccctaccgtcgagaaggtggtggagaggcggcagaggcggatgatcaagaacagggagtccgctgctaggtctcgcgcgcggaagcaggtgaagcctctcttctcttcaactgcactaggatgtaggaatacgtagcaatcttatgtccatttgcttgattaattagttctgaaaattcgatggtgcctatatttggtatgcctctcgataatgctgtactttattcacatgatgtgatccccccacttctaattcagcttgtagatgttaatttatgcctaatagccactgcaaatagcaagttagcgtcgttaaatattgttcaaccacagaggataagaatctaaagtgaataagccatggttcaagttgatgctctcagattcagagagatgatgagtggctttgttcatttcgggacactggctgagcggtgtttttttttttttttggatcgactattgctgtgatagggatagcatgctcaccatgaagcttggaaggacaattgacaagaccaattcgagaaatagtaacttccgttgatcttttctttaaaaaaaaaacttgtgggggtaataggtcttttttatgtgcaagttgtgctgccatgatgcactcatacttctataaaagctagtatatacttttattgttctaacatagcaaggtcaagtctttctgatactctgattgacagagaatagttctagacagttatggttgtgttgcgaaacacaattttttaacattaaattttggctttctgatatacaacaggcttatataatggagttggaagctgaggtggcaaaactgaaggaacagaaggctgaattgcagaaaaagcaggtatacctgctgtcatataaaattgctttgatccatgcatactctttatttttttctgtttctcttaccaattcctgtaatcagttagtagtccttagataacctcttgactttggataattcctatgtttcttgcctcgattgtcatatttgtttggggatttgggcttaccaatggctgttgttttaatctacccccagcaatgcttgttgctggtattgcaatatgtaggtgaccacaaatagcattcaaatgtccttgttctatgtatttcctgtggaatttatctgagttcaaatctttaatggttgttggaggtttgcacttaaaaggtgtatccctttttaatttgaacattgatggggttacattaattttgtattactgtcctgcaaacttgtattgaaatcctatgccatctggtatcttcttgttcacacattttccatgtgcctactattgttatgccagtatgtcattgtatcatgattttgtaattgaataacttaacaaaagcaccaaaccttttcttcttccaaattcctgacaaaaaatccatgaagctttattcacttattatgcttctaatttgcaggtggaaatgatacagaagcaaaatgatgaggtaatgaccttacagttggtagtaaataccatggttctgaattcgcactatgtttgtcctcattgatgtggaagttgtctatacctctttttgatcataccatactttcttcttttttaaataaaaaacaagagtaagttcatttccacaaacttgctgattaagggatctttggatctgggtgaattttttggggcatttgcaagtttggactaaagttctgatgacttgaatccagataccctctatatccaaacagacccaaattggggcaaaacaacaagctaactctatcgaaccaattcgtttttcttgctgtgagcctttcctaaaactggcagacgccttagaatctccatggctgaagtttgtcaaagtgcacaacaacagtagcattaggtcatttattagagctgcatgacattcaaattctttttaatgagctgcacaacaacatgcacgatttcccaattctggctgtgaggtgtgtttgttattgcattttttgtggtcatgtcagaaaatatcttactacatatggtttaaattatgtttcagaaatcccttattctttaaccaactgccatcataaatgtatatgctggtgttggccatatatttcatgtcactgacactctggcctcttatcccttctcattttcattcatgtatcatgttatctatgtagggtcattgtgttacatccatcttcagttttttaacactttagtgccatccacttgtggttttttttttcataaaataaatttgaagaaactaacagagatatgcaatactggaactcctgccattgcaatagaaaattagcacatcatgattttcagctatcacagtgtggattactgtgatgtgttttttgttaaaaaaaaatgtacactactttgtcctacactcgtccctgctgtcaaataattgagtttgccatgtacagagtaaatgtccagatgtgcaccattctgaatatggtatcccattttgggcatgcatgcttgtaacaccaaaattctgttggagaacatactacccaataagctcaaggtttcattttcaaaatctagttatctgtaattcccatgtcattatagttaaagtatttaattttctaccttctgttttatttttaactaatcagttcaattttttaaccaaagaatgatactcttttaccagggagatctgaagtgacttattggacatacaatgctaaaacaacaaactaaaacaacaaaatggacattgggtaggtttgtctgggtggtatgctcaacccagtctgatctggagtattaaaaagaatcctgactctaaatttagtccaccgctactatagacgctatagtgagcctgtccagcattcaaattaaggacattagttgtgttcgtttctaatggttgggaaccttccccctctagcatgtaaaacggagcaacgatttagcacacgatcaattaagtattagctaaaaaaaacttgaaaaaatggattaatataattttttaaaccaacttttctatagaaagtttttctagaaaacacattgtttagcagttttggaagcgtgcgtgcggaaaacaagtgagtagaggtgggaaagtgtagggaagatgtcatgttggtttgaattttgaaagtctgcaaactcttactaatgttacataaatagttttggttgctactctgcggtttcaagcagtaaacctctgcctcaatcattctgaagtttaagcatttctttgattataatcagtacagttagaaggccttaactgggtgcatttttatgttccgacttctgacgatctcactgaaatctgacaagtgttttctagctgaagatagtacattttactagatgctttgcaatgttgagaaagttctcttcatagattcttctttccctaacaggagttttatctataaatggattttgcaggtcatggagagaatcactcagcaacttggaccaaaggcaaagagattttgcctccgacgaacactgactggtccatggtaagttgatcaagtttgcacagcattgaccaaagttaagatcgttggcttccttggatgtgaccaatcgccgcgtgtatatatatcagctgaagccagagtctccggtttcgccgtggcgctcagcttcagagttgcttctctccttgttggtgaatggtgatggctcagtctcttggacggtcgaatgctggcgtcgattactcactaggtttagctgcgagatcgttgcgtgagcaaaggcatactatctaatctgtttaactccttatttagggaaatctggcatggtgaaaacggggcatgccatctgtgtttgttgtttttgtgcagctgttgcatctgctctgtatgttgctgttgcgttgacatgtcatcccgtttacagttcagtgattctgttctgtaccc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0211200, RefSeq:Os06g0211200