Difference between revisions of "Os01g0253300"

From RiceWiki
Jump to: navigation, search
m (→‎Evolution)
m (→‎Protein structure)
Line 18: Line 18:
 
===Protein structure===
 
===Protein structure===
 
1.The structure of rice importin alpha-1a  comprises 10 ARM repeats (green, cartoon representation) and two NLS-like sequences from the N-terminal IBB domain(shown in yellow stick )[FIG-5]<ref name="ref5" />.
 
1.The structure of rice importin alpha-1a  comprises 10 ARM repeats (green, cartoon representation) and two NLS-like sequences from the N-terminal IBB domain(shown in yellow stick )[FIG-5]<ref name="ref5" />.
 +
[[File:Fig5 crystal structure of importin.jpg]]
 +
 +
Fig-5:crystal structure of importin alpha-1a.From ref<ref name="ref5" />
 
2.The crystal structures of their complexes with rice importin alpha-1a show that they bind to the minor NLS binding site[Fig6A]. By contrast, the crystal structures of their complexes with mouse (Mus musculus) importin alpha-1ashow preferential binding to the major NLS binding site[Fig6B]. The results reveal the molecular basis of a number of features of the classical nuclear transport pathway specific to plants<ref name="ref5" />.
 
2.The crystal structures of their complexes with rice importin alpha-1a show that they bind to the minor NLS binding site[Fig6A]. By contrast, the crystal structures of their complexes with mouse (Mus musculus) importin alpha-1ashow preferential binding to the major NLS binding site[Fig6B]. The results reveal the molecular basis of a number of features of the classical nuclear transport pathway specific to plants<ref name="ref5" />.
 +
 
===Evolution===
 
===Evolution===
 
The phylogenetic tree of importin alpha shows that the rice importin alpha-1a protein is the most distant member from various organisms[Fig-7]<ref name="ref6" />.we could find another EST from Arabidopsis (accession number F15465), which has about 60% identity with #61L at the levelof both nucleotide and amino acid sequences. It might be interpreted that importin alpha-1a homologous to rice #61L(Refere to importin alpha-1a) is also present in Arabidopsis, and that the #61L protein and the homologue are functionally differentiated from the known importin alpha-1a.
 
The phylogenetic tree of importin alpha shows that the rice importin alpha-1a protein is the most distant member from various organisms[Fig-7]<ref name="ref6" />.we could find another EST from Arabidopsis (accession number F15465), which has about 60% identity with #61L at the levelof both nucleotide and amino acid sequences. It might be interpreted that importin alpha-1a homologous to rice #61L(Refere to importin alpha-1a) is also present in Arabidopsis, and that the #61L protein and the homologue are functionally differentiated from the known importin alpha-1a.

Revision as of 14:12, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Fig-1.Rice importina1 supported nuclear import of NLS-GFP in vertebratein vitroassay system.from ref[1]

Os01g0253300 encodes importin subunit alpha-1a,a member of importin family, which functions a essential role in nuclear protein import by specifically and directly binding to substrates containing either a simple or bipartite NLS motif[2].In vivo assay suggests that importin alpha-1a can replace vertebrate importin a in the mediation of nuclear import of NLS substrates, implying that rice importin a1 functions as a NLS receptor in the process of nuclear import of proteins(Fig-1)[1],which indicates the importin family has a conserved transportation function both in plants and mammals.The importin alpha-1a also has a function in virus infection by interact with mungbean yellow mosaic virus capsid protein[3].

Expression

Fig-2.Transcript analyses of rice importin.
Fig-3.An increase of importin-atranscript levels during dark-adaptation of light-grown green leaves.From ref[4]

Transcript analyses of rice importin alpha-1a by Chang-Jie Jiang et al shows importin alpha-1a is highly expressed in callus, followed by root and etiolated leaf and lowly expressed in green leaf(Fig-2)[2].The expression level of importin alpha-1a is greatly increased after darkt treatment in green leaf[Fig-3][4] .However it has a constitute expression pattern in non-photosynthetic tissues[Fig-4][3].Together,it indicates a complex regulation of the importin alpha-1a transcription.

Fig4 constitue exprssion.jpg

Fig-4.Importin-atranscript levels in different rice tissues.(A) RNA was prepared from various tissues, roots (Root), mature leaf blades (M-Leaf), flag leaf blades (F-Leaf), stems (Stem) and suspension-cultured cells (Callus), and the transcript levels for importin-α in their tissues were examined by RNA blot analysis. Mature leaves, flag leaves and stems of field-grown plants were collected at noon on a sunny day in July. (B) The effect of illumination on the transcript levels for importin-α was examined in roots and suspension-cultured cells. Roots of water-cultured seedlings and suspension-cultured cells were exposed to white light (white fluorescent lamps; 90 μmol m−2 s−1) for 24 h (L), kept in complete darkness for 24 h (D) or kept in darkness for 24 h and then re-illuminated for 3 h (+3hL).From ref [3]

Protein structure

1.The structure of rice importin alpha-1a comprises 10 ARM repeats (green, cartoon representation) and two NLS-like sequences from the N-terminal IBB domain(shown in yellow stick )[FIG-5][5]. Fig5 crystal structure of importin.jpg

Fig-5:crystal structure of importin alpha-1a.From ref[5] 2.The crystal structures of their complexes with rice importin alpha-1a show that they bind to the minor NLS binding site[Fig6A]. By contrast, the crystal structures of their complexes with mouse (Mus musculus) importin alpha-1ashow preferential binding to the major NLS binding site[Fig6B]. The results reveal the molecular basis of a number of features of the classical nuclear transport pathway specific to plants[5].

Evolution

The phylogenetic tree of importin alpha shows that the rice importin alpha-1a protein is the most distant member from various organisms[Fig-7][6].we could find another EST from Arabidopsis (accession number F15465), which has about 60% identity with #61L at the levelof both nucleotide and amino acid sequences. It might be interpreted that importin alpha-1a homologous to rice #61L(Refere to importin alpha-1a) is also present in Arabidopsis, and that the #61L protein and the homologue are functionally differentiated from the known importin alpha-1a.

Fig 7.jpg

Fig-7:(Phylogenetic tree of importinK. The tree was constructed by the UPGMA method using the GENETYX-MAC 7.3 software(Software Development Co., Tokyo) with default parameters. The accession number of the putative open reading frame T10M13.16 which is predicted ) From[6]

Labs working on this gene

  • National Institute of Agrobiological Resources, Tsukuba, Ibaraki 305-8602, Japan.
  • Friedrich Miescher Institute, Maulbeerstrasse 66, 4058 Basel, Switzerland.
  • Central Research Institute of Electric Power Industry, Chiba, Japan.
  • School of Chemistry and Molecular Biosciences and Institute for Molecular Bioscience, University of Queensland, Brisbane Qld 4072, Australia.
  • School of Chemistry and Molecular Biosciences, Institute for Molecular Bioscience, and Australian Infectious Diseases Research Centre, University of Queensland, Brisbane, Qld 4072, Australia.
  • The State Key Laboratory of Protein and Plant Gene Research, College of Life Sciences, Peking University, Beijing, China.
  • Department of Biochemistry and Graduate Institute of Life Sciences, National Defense Medical Center, Taipei, Taiwan 114, Republic of China.

References

  1. ↑ 1.0 1.1 Jiang CJ, Imamoto N, Matsuki R, Yoneda Y, Yamamoto N. Functional characterization of a plant importin alpha homologue. J Biol Chem. 1998 Sep 11.
  2. ↑ 2.0 2.1 Jiang CJ, Shoji K, Matsuki R, Baba A, Inagaki N, Ban H, Iwasaki T, Imamoto N, Yoneda Y, Deng XW, Yamamoto N. Molecular cloning of a novel importin alpha homologue from rice, by which constitutive photomorphogenic 1 (COP1) nuclear localization signal (NLS)-protein is preferentially nuclear imported. J Biol Chem. 2001 Mar 23;276(12):9322-9. Epub 2000 Dec 20.
  3. ↑ 3.0 3.1 3.2 Guerra-Peraza O, Kirk D, Seltzer V, Veluthambi K, Schmit AC, Hohn T, Herzog E. Coat proteins of Rice tungro bacilliform virus and Mungbean yellow mosaic virus contain multiple nuclear-localization signals and interact with importin alpha. J Gen Virol. 2005 Jun;86(Pt 6):1815-26.
  4. ↑ 4.0 4.1 Shoji K, Iwasaki T, Matsuki R, Miyao M, Yamamoto N. Cloning of a cDNA encoding an importin-alpha and down-regulation of the gene by light in rice leaves. Gene. 1998 Jun 8;212(2):279-86.
  5. ↑ 5.0 5.1 5.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  6. ↑ 6.0 6.1 Iwasaki T, Matsuki R, Shoji K, Sanmiya K, Miyao M, Yamamoto N. A novel importin alpha from rice, a component involved in the process of nuclear protein transport. FEBS Lett. 1998 May 29;428(3):259-62.

Structured Information

Gene Name

Os01g0253300

Description

Importin alpha-1a subunit

Version

NM_001049146.1 GI:115435705 GeneID:4327117

Length

5116 bp

Definition

Oryza sativa Japonica Group Os01g0253300, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:8381095..8386210

Sequence Coding Region

8381261..8381470,8382333..8382429,8382526..8382617,8382709..8382840,8382955..8383140
,8383224..8383387,8383494..8383572,8384464..8384592,8385082..8385209
,8385328..8385691

Expression

GEO Profiles:Os01g0253300

Genome Context

<gbrowseImage1> name=NC_008394:8381095..8386210 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:8381095..8386210 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcgctgcgcccgagcgagcgggtggaggtgcggcggaaccgctacaaggtggcggtggacgccgaggaggggaggcggcggcgcgaggacaacatggtggagatccgcaagagccgccgcgaggagagcctcctcaagaagcgccgcgaggggctccaggcccaggcccccgtccccgcctccgccgcaaccggcgtcgataagaagctcgaaagccttcctgctatgattggtggagtttattcggacgataacaaccttcagcttgaggccacaacacagttccgcaagttgctttctatagagaggagccctccaattgaagaggttattcaatcaggcgttgttcctagattcgtgcagtttcttaccagagaggatttcccccagctacagttcgaagctgcgtgggcacttacaaacattgcatctggcacttcggagaatacaaaggttgtcattgatcatggggctgtaccaatatttgtgaagcttcttggttcttctagtgatgatgttcgtgagcaggctgtatgggcattgggcaatgttgctggtgattcccctaagtgccgtgaccttgttcttgccaatggtgcattgctgcctctgctagcacagttgaatgagcacactaaactctctatgctaaggaatgcaacttggactttatcgaacttctgcagaggaaaaccacagccatcatttgaacagactaggcctgctcttccagcactggcacggcttattcactccaatgatgaggaagttctcactgatgcgtgctgggctctttcatatttatctgatggcactaatgacaagatccaagccgtgattgaagctggtgtttgcccccgtcttgtggagcttctcctccatccatcaccttcagtgcttatacccgcactacgaactgttggaaatattgtaactggagatgacgcgcaaactcagtgcatcattgatcatcaagccctcccttgcctcctaagtctgttgacacaaaatctcaagaaaagcatcaagaaagaggcttgctggactatttcaaatattactgctggtaacaaagatcagatacaggctgtcataaatgctggcattattggtcctctggtgaatctgctccaaacggcagagttcgatatcaagaaggaagctgcatgggccatctcaaatgctacttcaggcggtagccatgatcaaatcaagtatctggtgagcgagggctgcatcaagccattgtgtgatcttcttatttgcccagatataagaatcgttacagtttgtttggagggtctcgagaacattcttaaagtaggagaaaccgacaagaccttggctgcaggtgatgtgaatgtcttttcccagatgattgatgaagcggaaggtttggaaaagattgagaacttgcagagccatgataacaatgagatctatgaaaaagctgtgaagattcttgaggcctactggatggatgaggaggatgatacaatgggagctaccacggtagctgctccccaaggtgctacttttgactttggccaaggcggtggtgctgctcaattcaaataa</cdnaseq>

Protein Sequence

<aaseq>MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREES LLKKRREGLQAQAPVPASAATGVDKKLESLPAMIGGVYSDDNNLQLEATTQFRKLLSI ERSPPIEEVIQSGVVPRFVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAV PIFVKLLGSSSDDVREQAVWALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSML RNATWTLSNFCRGKPQPSFEQTRPALPALARLIHSNDEEVLTDACWALSYLSDGTNDK IQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSL LTQNLKKSIKKEACWTISNITAGNKDQIQAVINAGIIGPLVNLLQTAEFDIKKEAAWA ISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIRIVTVCLEGLENILKVGETDKTLA AGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYEKAVKILEAYWMDEEDDTMGATTVAA PQGATFDFGQGGGAAQFK</aaseq>

Gene Sequence

<dnaseqindica>167..376#1239..1335#1432..1523#1615..1746#1861..2046#2130..2293#2400..2478#3370..3498#3988..4115#4234..4597#gtgtgagctttaactccccccctttccccgcggccactagggtttctcctcctctttcctctcctcctccgccccgacgcctcgctagggtttttgcctctccctccgccgccgccgctgccgcgaggagaggagggggggagagcacccagccggcgagccagccatgtcgctgcgcccgagcgagcgggtggaggtgcggcggaaccgctacaaggtggcggtggacgccgaggaggggaggcggcggcgcgaggacaacatggtggagatccgcaagagccgccgcgaggagagcctcctcaagaagcgccgcgaggggctccaggcccaggcccccgtccccgcctccgccgcaaccggcgtcgataagaaggtgagtagtatactcctcgattcccccccgctcccctcccctcccctcccctgcctccgatgacgctatcccatcgtgtcctggatcccatattttaggtaggtgttggattggattgcactttttgagagggtttttgattcgtctgcggcatatttgtttaagtttgttattatacccgcatgtctactagcgtgcgggtgagggtaggttcctgctagatgtaggcaacacttagcaccacgtttcgatgcctcgattagtcacttgatttctgattctccttctgttgacaatattacaagtactgttagttggcacggttgcgaactcctagcgtttgaaatgtttccaggtacatgcctgctagctccagtgatctagttttagttttaggacatgtagattgtggtcttaggatcaaatcttccacggattcactgcggataattagttaggtgaccaggaactgtaataatgattgatcttcctgataatttttagtgtacatcttgctgttgtttcatcttatgttttgatagaagcatacaaatgagctgatgccatattatatctttatagctattttttgtgctatcttgaaattgagggtccagtgcaactttccttatgactgaaccttgtctttagtacatggaagcacataaatcatatagtagtgtttctggtcatgtttctagagacgtcctacattgataacgcatacatttatgttactgttaaactacctctggtttctgttctttgcaccacccctaaaagagaaggaaactgcttttaaaccctttttggggtttaatacgggaagttgagtatttgatatctctgttgaatgttgtagctcgaaagccttcctgctatgattggtggagtttattcggacgataacaaccttcagcttgaggccacaacacagttccgcaagttgctttctataggtacaaacctcttaaatgttttgggctgttaccttgtgaaaataatagttgaacaaaagttaattactaattacacccattacaatttttaattagagaggagccctccaattgaagaggttattcaatcaggcgttgttcctagattcgtgcagtttcttaccagagaggatttcccccagctacaggtgtgtgccaacacaatattattttcattatctggtaggttcaaataaaaatggatttattactgtggtgcttttgaattaaattttgtagttcgaagctgcgtgggcacttacaaacattgcatctggcacttcggagaatacaaaggttgtcattgatcatggggctgtaccaatatttgtgaagcttcttggttcttctagtgatgatgttcgtgagcaggtatccgatcatctcctgacttgtctttgtgctttctgtacttccttgatattattttgattgagtgcattgttggagttattaatgtttttacctcttgaaaaaaaattgaaggctgtatgggcattgggcaatgttgctggtgattcccctaagtgccgtgaccttgttcttgccaatggtgcattgctgcctctgctagcacagttgaatgagcacactaaactctctatgctaaggaatgcaacttggactttatcgaacttctgcagaggaaaaccacagccatcatttgaacaggtttggacaaagtttctttgtactctactgtagttagtagggaaagacagttccttaacatgatgtttattgggtgtcaatagactaggcctgctcttccagcactggcacggcttattcactccaatgatgaggaagttctcactgatgcgtgctgggctctttcatatttatctgatggcactaatgacaagatccaagccgtgattgaagctggtgtttgcccccgtcttgtggagcttctcctgtaagtgacaacattgcattacaattttctgccattttcctttagattcttatttgctactctcattataccctttttaatattttatactgtttacaacatgaagccatccatcaccttcagtgcttatacccgcactacgaactgttggaaatattgtaactggagatgacgcgcaaactcaggtattgtgttgattttttgcatctctatatctgacagattttgtatcaattgatatcaactactaagactcatgaatcttgagcttaatatttagaggttgtgttcatcacagttgatattaaattttaggcttgtggaaaatgtttaatatcatagttgatattaaatctagaggttgcatctaatgtggaaaatgttttgtaaaaactattgaaaaataaatgcacatatttgtcatatgtagatgcacatgtttggcaatttgacctactctttacgcccatcaattaaagatttgtctagtttgtgtcacttaaatacttgagatttgtcctctcacagtatcacttagatctatactctatactactttaaaaggtagtagtggtggtggcagtgaatctgccagcactacctctatcactaatgtatgggccctccatgttgggtgaaacccacatgctcaataaatttaaacgtcctccaaaagataatgtccatattgtttggtaagatctacagggaaggaatccataaaggggttgaaaagagccagtctacatattcttcaaatgatgagcatgcagtgtgcacagcatgatttttttttcattgcaacgcataggcaatttgctagtttgcctaaaaattcattgcctgctttgcagcaagtcatagctgctgtacttgtttcagccaaacttggcttttcttattgtattcttattattgtttgagttttaggagagctgagaatttttctgctatgctaaagctggtgttcatataatatgaaatatctactgtagatcacagcatgaaagttaattgcttttttgacatccatattgccatctcatcatctccccccaccccctttttttgtacagtgcatcattgatcatcaagccctcccttgcctcctaagtctgttgacacaaaatctcaagaaaagcatcaagaaagaggcttgctggactatttcaaatattactgctggtaacaaagatcagatacaggtatgtgtacagacttaaaaaatactgacatgctcatcattctactaagtcatgaaggatttgtgtagtgcatacttagtagttttaattgtgttccctctccaaaccataaacaccacacaatgttcatattccatgcaagctttcaggtcaacttttcctttcatgatgattacacttgttagcagactcatccttgttgtacaaagactgagaacatggtagtaacttaaagaaacccttatgtatgatttgctcgcaaagtatcaatggcagcctaatcactagtccaaatgttgctgctgggacctggggtcctagaaggggaggggatgggagcatatggatgattgattcatttacacggttgggaacttgtgcacttagctgcaatctttcgtccttaacctataatagcctatagctatagatcttgttgattgtgcatgttctgaaatgttcaacaatttgctgcattgactaccataggctgtcataaatgctggcattattggtcctctggtgaatctgctccaaacggcagagttcgatatcaagaaggaagctgcatgggccatctcaaatgctacttcaggcggtagccatgatcaaatcaagtatgtttactcaccttgcaccagttctattcagctttatgaaatgcaaatataaccgctttcatagtttcatgttaagcttcatttggatttgatattgtatggtttgttaaaataggtatctggtgagcgagggctgcatcaagccattgtgtgatcttcttatttgcccagatataagaatcgttacagtttgtttggagggtctcgagaacattcttaaagtaggagaaaccgacaagaccttggctgcaggtgatgtgaatgtcttttcccagatgattgatgaagcggaaggtttggaaaagattgagaacttgcagagccatgataacaatgagatctatgaaaaagctgtgaagattcttgaggcctactggatggatgaggaggatgatacaatgggagctaccacggtagctgctccccaaggtgctacttttgactttggccaaggcggtggtgctgctcaattcaaataaatacaggtactctcaatcctcaacatggtttgtgtttattgtgggttgtttccactcttaccataaatcctttctgttctggtatcattcacttgaggcaacaagtaatgatttcaaatttcctcgacagatttgaccagaggtggtaaattgtggccactgtgcggggtactgaattgttctggtggttcaataagctaaaggtttcaagggggccagtgttacattatttccctactggtcacggatatcatatcactacgtctgtaacagggattaaagctttgaagtctgcgtttttcatcaggctactactatgtagtgtttgcatcttttagtatggtgtgcaacattttgctacttgtatagcctgagtcgaagcttctgcaaagccgtcacaacacattcctgaacccgtctggttttgagtttcgtcaggagtgtgctgagttgcagtttgtccggacatgtaaaccattatgccttttaaattatatattgctagggtttgttcggttc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0253300, RefSeq:Os01g0253300

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os01g0253300&oldid=179296"