Difference between revisions of "Os01g0253300"

From RiceWiki
Jump to: navigation, search
m (Protein structure)
m (Protein structure)
Line 21: Line 21:
  
 
Fig-5:crystal structure of importin alpha-1a.From ref<ref name="ref5" />
 
Fig-5:crystal structure of importin alpha-1a.From ref<ref name="ref5" />
 +
 
2.The crystal structures of their complexes with rice importin alpha-1a show that they bind to the minor NLS binding site[Fig6A]. By contrast, the crystal structures of their complexes with mouse (Mus musculus) importin alpha-1ashow preferential binding to the major NLS binding site[Fig6B]. The results reveal the molecular basis of a number of features of the classical nuclear transport pathway specific to plants<ref name="ref5" />.
 
2.The crystal structures of their complexes with rice importin alpha-1a show that they bind to the minor NLS binding site[Fig6A]. By contrast, the crystal structures of their complexes with mouse (Mus musculus) importin alpha-1ashow preferential binding to the major NLS binding site[Fig6B]. The results reveal the molecular basis of a number of features of the classical nuclear transport pathway specific to plants<ref name="ref5" />.
  

Revision as of 14:12, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Fig-1.Rice importina1 supported nuclear import of NLS-GFP in vertebratein vitroassay system.from ref[1]

Os01g0253300 encodes importin subunit alpha-1a,a member of importin family, which functions a essential role in nuclear protein import by specifically and directly binding to substrates containing either a simple or bipartite NLS motif[2].In vivo assay suggests that importin alpha-1a can replace vertebrate importin a in the mediation of nuclear import of NLS substrates, implying that rice importin a1 functions as a NLS receptor in the process of nuclear import of proteins(Fig-1)[1],which indicates the importin family has a conserved transportation function both in plants and mammals.The importin alpha-1a also has a function in virus infection by interact with mungbean yellow mosaic virus capsid protein[3].

Expression

Fig-2.Transcript analyses of rice importin.
Fig-3.An increase of importin-atranscript levels during dark-adaptation of light-grown green leaves.From ref[4]

Transcript analyses of rice importin alpha-1a by Chang-Jie Jiang et al shows importin alpha-1a is highly expressed in callus, followed by root and etiolated leaf and lowly expressed in green leaf(Fig-2)[2].The expression level of importin alpha-1a is greatly increased after darkt treatment in green leaf[Fig-3][4] .However it has a constitute expression pattern in non-photosynthetic tissues[Fig-4][3].Together,it indicates a complex regulation of the importin alpha-1a transcription.

Fig4 constitue exprssion.jpg

Fig-4.Importin-atranscript levels in different rice tissues.(A) RNA was prepared from various tissues, roots (Root), mature leaf blades (M-Leaf), flag leaf blades (F-Leaf), stems (Stem) and suspension-cultured cells (Callus), and the transcript levels for importin-α in their tissues were examined by RNA blot analysis. Mature leaves, flag leaves and stems of field-grown plants were collected at noon on a sunny day in July. (B) The effect of illumination on the transcript levels for importin-α was examined in roots and suspension-cultured cells. Roots of water-cultured seedlings and suspension-cultured cells were exposed to white light (white fluorescent lamps; 90 μmol m−2 s−1) for 24 h (L), kept in complete darkness for 24 h (D) or kept in darkness for 24 h and then re-illuminated for 3 h (+3hL).From ref [3]

Protein structure

1.The structure of rice importin alpha-1a comprises 10 ARM repeats (green, cartoon representation) and two NLS-like sequences from the N-terminal IBB domain(shown in yellow stick )[FIG-5][5]. Fig5 crystal structure of importin.jpg

Fig-5:crystal structure of importin alpha-1a.From ref[5]

2.The crystal structures of their complexes with rice importin alpha-1a show that they bind to the minor NLS binding site[Fig6A]. By contrast, the crystal structures of their complexes with mouse (Mus musculus) importin alpha-1ashow preferential binding to the major NLS binding site[Fig6B]. The results reveal the molecular basis of a number of features of the classical nuclear transport pathway specific to plants[5].

Evolution

The phylogenetic tree of importin alpha shows that the rice importin alpha-1a protein is the most distant member from various organisms[Fig-7][6].we could find another EST from Arabidopsis (accession number F15465), which has about 60% identity with #61L at the levelof both nucleotide and amino acid sequences. It might be interpreted that importin alpha-1a homologous to rice #61L(Refere to importin alpha-1a) is also present in Arabidopsis, and that the #61L protein and the homologue are functionally differentiated from the known importin alpha-1a.

Fig 7.jpg

Fig-7:(Phylogenetic tree of importinK. The tree was constructed by the UPGMA method using the GENETYX-MAC 7.3 software(Software Development Co., Tokyo) with default parameters. The accession number of the putative open reading frame T10M13.16 which is predicted ) From[6]

Labs working on this gene

  • National Institute of Agrobiological Resources, Tsukuba, Ibaraki 305-8602, Japan.
  • Friedrich Miescher Institute, Maulbeerstrasse 66, 4058 Basel, Switzerland.
  • Central Research Institute of Electric Power Industry, Chiba, Japan.
  • School of Chemistry and Molecular Biosciences and Institute for Molecular Bioscience, University of Queensland, Brisbane Qld 4072, Australia.
  • School of Chemistry and Molecular Biosciences, Institute for Molecular Bioscience, and Australian Infectious Diseases Research Centre, University of Queensland, Brisbane, Qld 4072, Australia.
  • The State Key Laboratory of Protein and Plant Gene Research, College of Life Sciences, Peking University, Beijing, China.
  • Department of Biochemistry and Graduate Institute of Life Sciences, National Defense Medical Center, Taipei, Taiwan 114, Republic of China.

References

  1. 1.0 1.1 Jiang CJ, Imamoto N, Matsuki R, Yoneda Y, Yamamoto N. Functional characterization of a plant importin alpha homologue. J Biol Chem. 1998 Sep 11.
  2. 2.0 2.1 Jiang CJ, Shoji K, Matsuki R, Baba A, Inagaki N, Ban H, Iwasaki T, Imamoto N, Yoneda Y, Deng XW, Yamamoto N. Molecular cloning of a novel importin alpha homologue from rice, by which constitutive photomorphogenic 1 (COP1) nuclear localization signal (NLS)-protein is preferentially nuclear imported. J Biol Chem. 2001 Mar 23;276(12):9322-9. Epub 2000 Dec 20.
  3. 3.0 3.1 3.2 Guerra-Peraza O, Kirk D, Seltzer V, Veluthambi K, Schmit AC, Hohn T, Herzog E. Coat proteins of Rice tungro bacilliform virus and Mungbean yellow mosaic virus contain multiple nuclear-localization signals and interact with importin alpha. J Gen Virol. 2005 Jun;86(Pt 6):1815-26.
  4. 4.0 4.1 Shoji K, Iwasaki T, Matsuki R, Miyao M, Yamamoto N. Cloning of a cDNA encoding an importin-alpha and down-regulation of the gene by light in rice leaves. Gene. 1998 Jun 8;212(2):279-86.
  5. 5.0 5.1 5.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  6. 6.0 6.1 Iwasaki T, Matsuki R, Shoji K, Sanmiya K, Miyao M, Yamamoto N. A novel importin alpha from rice, a component involved in the process of nuclear protein transport. FEBS Lett. 1998 May 29;428(3):259-62.

Structured Information

Gene Name

Os01g0253300

Description

Importin alpha-1a subunit

Version

NM_001049146.1 GI:115435705 GeneID:4327117

Length

5116 bp

Definition

Oryza sativa Japonica Group Os01g0253300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:8381095..8386210

Sequence Coding Region

8381261..8381470,8382333..8382429,8382526..8382617,8382709..8382840,8382955..8383140
,8383224..8383387,8383494..8383572,8384464..8384592,8385082..8385209
,8385328..8385691

Expression

GEO Profiles:Os01g0253300

Genome Context

<gbrowseImage1> name=NC_008394:8381095..8386210 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:8381095..8386210 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtcgctgcgcccgagcgagcgggtggaggtgcggcggaaccgctacaaggtggcggtggacgccgaggaggggaggcggcggcgcgaggacaacatggtggagatccgcaagagccgccgcgaggagagcctcctcaagaagcgccgcgaggggctccaggcccaggcccccgtccccgcctccgccgcaaccggcgtcgataagaagctcgaaagccttcctgctatgattggtggagtttattcggacgataacaaccttcagcttgaggccacaacacagttccgcaagttgctttctatagagaggagccctccaattgaagaggttattcaatcaggcgttgttcctagattcgtgcagtttcttaccagagaggatttcccccagctacagttcgaagctgcgtgggcacttacaaacattgcatctggcacttcggagaatacaaaggttgtcattgatcatggggctgtaccaatatttgtgaagcttcttggttcttctagtgatgatgttcgtgagcaggctgtatgggcattgggcaatgttgctggtgattcccctaagtgccgtgaccttgttcttgccaatggtgcattgctgcctctgctagcacagttgaatgagcacactaaactctctatgctaaggaatgcaacttggactttatcgaacttctgcagaggaaaaccacagccatcatttgaacagactaggcctgctcttccagcactggcacggcttattcactccaatgatgaggaagttctcactgatgcgtgctgggctctttcatatttatctgatggcactaatgacaagatccaagccgtgattgaagctggtgtttgcccccgtcttgtggagcttctcctccatccatcaccttcagtgcttatacccgcactacgaactgttggaaatattgtaactggagatgacgcgcaaactcagtgcatcattgatcatcaagccctcccttgcctcctaagtctgttgacacaaaatctcaagaaaagcatcaagaaagaggcttgctggactatttcaaatattactgctggtaacaaagatcagatacaggctgtcataaatgctggcattattggtcctctggtgaatctgctccaaacggcagagttcgatatcaagaaggaagctgcatgggccatctcaaatgctacttcaggcggtagccatgatcaaatcaagtatctggtgagcgagggctgcatcaagccattgtgtgatcttcttatttgcccagatataagaatcgttacagtttgtttggagggtctcgagaacattcttaaagtaggagaaaccgacaagaccttggctgcaggtgatgtgaatgtcttttcccagatgattgatgaagcggaaggtttggaaaagattgagaacttgcagagccatgataacaatgagatctatgaaaaagctgtgaagattcttgaggcctactggatggatgaggaggatgatacaatgggagctaccacggtagctgctccccaaggtgctacttttgactttggccaaggcggtggtgctgctcaattcaaataa</cdnaseq>

Protein Sequence

<aaseq>MSLRPSERVEVRRNRYKVAVDAEEGRRRREDNMVEIRKSRREES LLKKRREGLQAQAPVPASAATGVDKKLESLPAMIGGVYSDDNNLQLEATTQFRKLLSI ERSPPIEEVIQSGVVPRFVQFLTREDFPQLQFEAAWALTNIASGTSENTKVVIDHGAV PIFVKLLGSSSDDVREQAVWALGNVAGDSPKCRDLVLANGALLPLLAQLNEHTKLSML RNATWTLSNFCRGKPQPSFEQTRPALPALARLIHSNDEEVLTDACWALSYLSDGTNDK IQAVIEAGVCPRLVELLLHPSPSVLIPALRTVGNIVTGDDAQTQCIIDHQALPCLLSL LTQNLKKSIKKEACWTISNITAGNKDQIQAVINAGIIGPLVNLLQTAEFDIKKEAAWA ISNATSGGSHDQIKYLVSEGCIKPLCDLLICPDIRIVTVCLEGLENILKVGETDKTLA AGDVNVFSQMIDEAEGLEKIENLQSHDNNEIYEKAVKILEAYWMDEEDDTMGATTVAA PQGATFDFGQGGGAAQFK</aaseq>

Gene Sequence

<dnaseqindica>167..376#1239..1335#1432..1523#1615..1746#1861..2046#2130..2293#2400..2478#3370..3498#3988..4115#4234..4597#gtgtgagctttaactccccccctttccccgcggccactagggtttctcctcctctttcctctcctcctccgccccgacgcctcgctagggtttttgcctctccctccgccgccgccgctgccgcgaggagaggagggggggagagcacccagccggcgagccagccatgtcgctgcgcccgagcgagcgggtggaggtgcggcggaaccgctacaaggtggcggtggacgccgaggaggggaggcggcggcgcgaggacaacatggtggagatccgcaagagccgccgcgaggagagcctcctcaagaagcgccgcgaggggctccaggcccaggcccccgtccccgcctccgccgcaaccggcgtcgataagaaggtgagtagtatactcctcgattcccccccgctcccctcccctcccctcccctgcctccgatgacgctatcccatcgtgtcctggatcccatattttaggtaggtgttggattggattgcactttttgagagggtttttgattcgtctgcggcatatttgtttaagtttgttattatacccgcatgtctactagcgtgcgggtgagggtaggttcctgctagatgtaggcaacacttagcaccacgtttcgatgcctcgattagtcacttgatttctgattctccttctgttgacaatattacaagtactgttagttggcacggttgcgaactcctagcgtttgaaatgtttccaggtacatgcctgctagctccagtgatctagttttagttttaggacatgtagattgtggtcttaggatcaaatcttccacggattcactgcggataattagttaggtgaccaggaactgtaataatgattgatcttcctgataatttttagtgtacatcttgctgttgtttcatcttatgttttgatagaagcatacaaatgagctgatgccatattatatctttatagctattttttgtgctatcttgaaattgagggtccagtgcaactttccttatgactgaaccttgtctttagtacatggaagcacataaatcatatagtagtgtttctggtcatgtttctagagacgtcctacattgataacgcatacatttatgttactgttaaactacctctggtttctgttctttgcaccacccctaaaagagaaggaaactgcttttaaaccctttttggggtttaatacgggaagttgagtatttgatatctctgttgaatgttgtagctcgaaagccttcctgctatgattggtggagtttattcggacgataacaaccttcagcttgaggccacaacacagttccgcaagttgctttctataggtacaaacctcttaaatgttttgggctgttaccttgtgaaaataatagttgaacaaaagttaattactaattacacccattacaatttttaattagagaggagccctccaattgaagaggttattcaatcaggcgttgttcctagattcgtgcagtttcttaccagagaggatttcccccagctacaggtgtgtgccaacacaatattattttcattatctggtaggttcaaataaaaatggatttattactgtggtgcttttgaattaaattttgtagttcgaagctgcgtgggcacttacaaacattgcatctggcacttcggagaatacaaaggttgtcattgatcatggggctgtaccaatatttgtgaagcttcttggttcttctagtgatgatgttcgtgagcaggtatccgatcatctcctgacttgtctttgtgctttctgtacttccttgatattattttgattgagtgcattgttggagttattaatgtttttacctcttgaaaaaaaattgaaggctgtatgggcattgggcaatgttgctggtgattcccctaagtgccgtgaccttgttcttgccaatggtgcattgctgcctctgctagcacagttgaatgagcacactaaactctctatgctaaggaatgcaacttggactttatcgaacttctgcagaggaaaaccacagccatcatttgaacaggtttggacaaagtttctttgtactctactgtagttagtagggaaagacagttccttaacatgatgtttattgggtgtcaatagactaggcctgctcttccagcactggcacggcttattcactccaatgatgaggaagttctcactgatgcgtgctgggctctttcatatttatctgatggcactaatgacaagatccaagccgtgattgaagctggtgtttgcccccgtcttgtggagcttctcctgtaagtgacaacattgcattacaattttctgccattttcctttagattcttatttgctactctcattataccctttttaatattttatactgtttacaacatgaagccatccatcaccttcagtgcttatacccgcactacgaactgttggaaatattgtaactggagatgacgcgcaaactcaggtattgtgttgattttttgcatctctatatctgacagattttgtatcaattgatatcaactactaagactcatgaatcttgagcttaatatttagaggttgtgttcatcacagttgatattaaattttaggcttgtggaaaatgtttaatatcatagttgatattaaatctagaggttgcatctaatgtggaaaatgttttgtaaaaactattgaaaaataaatgcacatatttgtcatatgtagatgcacatgtttggcaatttgacctactctttacgcccatcaattaaagatttgtctagtttgtgtcacttaaatacttgagatttgtcctctcacagtatcacttagatctatactctatactactttaaaaggtagtagtggtggtggcagtgaatctgccagcactacctctatcactaatgtatgggccctccatgttgggtgaaacccacatgctcaataaatttaaacgtcctccaaaagataatgtccatattgtttggtaagatctacagggaaggaatccataaaggggttgaaaagagccagtctacatattcttcaaatgatgagcatgcagtgtgcacagcatgatttttttttcattgcaacgcataggcaatttgctagtttgcctaaaaattcattgcctgctttgcagcaagtcatagctgctgtacttgtttcagccaaacttggcttttcttattgtattcttattattgtttgagttttaggagagctgagaatttttctgctatgctaaagctggtgttcatataatatgaaatatctactgtagatcacagcatgaaagttaattgcttttttgacatccatattgccatctcatcatctccccccaccccctttttttgtacagtgcatcattgatcatcaagccctcccttgcctcctaagtctgttgacacaaaatctcaagaaaagcatcaagaaagaggcttgctggactatttcaaatattactgctggtaacaaagatcagatacaggtatgtgtacagacttaaaaaatactgacatgctcatcattctactaagtcatgaaggatttgtgtagtgcatacttagtagttttaattgtgttccctctccaaaccataaacaccacacaatgttcatattccatgcaagctttcaggtcaacttttcctttcatgatgattacacttgttagcagactcatccttgttgtacaaagactgagaacatggtagtaacttaaagaaacccttatgtatgatttgctcgcaaagtatcaatggcagcctaatcactagtccaaatgttgctgctgggacctggggtcctagaaggggaggggatgggagcatatggatgattgattcatttacacggttgggaacttgtgcacttagctgcaatctttcgtccttaacctataatagcctatagctatagatcttgttgattgtgcatgttctgaaatgttcaacaatttgctgcattgactaccataggctgtcataaatgctggcattattggtcctctggtgaatctgctccaaacggcagagttcgatatcaagaaggaagctgcatgggccatctcaaatgctacttcaggcggtagccatgatcaaatcaagtatgtttactcaccttgcaccagttctattcagctttatgaaatgcaaatataaccgctttcatagtttcatgttaagcttcatttggatttgatattgtatggtttgttaaaataggtatctggtgagcgagggctgcatcaagccattgtgtgatcttcttatttgcccagatataagaatcgttacagtttgtttggagggtctcgagaacattcttaaagtaggagaaaccgacaagaccttggctgcaggtgatgtgaatgtcttttcccagatgattgatgaagcggaaggtttggaaaagattgagaacttgcagagccatgataacaatgagatctatgaaaaagctgtgaagattcttgaggcctactggatggatgaggaggatgatacaatgggagctaccacggtagctgctccccaaggtgctacttttgactttggccaaggcggtggtgctgctcaattcaaataaatacaggtactctcaatcctcaacatggtttgtgtttattgtgggttgtttccactcttaccataaatcctttctgttctggtatcattcacttgaggcaacaagtaatgatttcaaatttcctcgacagatttgaccagaggtggtaaattgtggccactgtgcggggtactgaattgttctggtggttcaataagctaaaggtttcaagggggccagtgttacattatttccctactggtcacggatatcatatcactacgtctgtaacagggattaaagctttgaagtctgcgtttttcatcaggctactactatgtagtgtttgcatcttttagtatggtgtgcaacattttgctacttgtatagcctgagtcgaagcttctgcaaagccgtcacaacacattcctgaacccgtctggttttgagtttcgtcaggagtgtgctgagttgcagtttgtccggacatgtaaaccattatgccttttaaattatatattgctagggtttgttcggttc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0253300, RefSeq:Os01g0253300