Difference between revisions of "Os02g0534400"

From RiceWiki
Jump to: navigation, search
(References)
(Function)
Line 5: Line 5:
  
 
''OsCIN1'', a rice ''CIN'' gene, is active in developing seeds. ''OsCIN1'' has a critical role during the pre-storage phase, being involved in the proliferation of endosperm cells and longitudinal growth of immature seeds, rather than during the starch-filling phase.Cell-wall invertase (CIN) catalyzes the hydrolysis of sucrose into glucose and fructose for the supply of carbohydrates to sink organs via an apoplastic pathway.CINs are most active in the apoplast of sink organs,and can be involved in sucrose partitioning, control of cell differentiation and plant development, and responses to wounding and pathogen infection.<ref name="ref1"/>
 
''OsCIN1'', a rice ''CIN'' gene, is active in developing seeds. ''OsCIN1'' has a critical role during the pre-storage phase, being involved in the proliferation of endosperm cells and longitudinal growth of immature seeds, rather than during the starch-filling phase.Cell-wall invertase (CIN) catalyzes the hydrolysis of sucrose into glucose and fructose for the supply of carbohydrates to sink organs via an apoplastic pathway.CINs are most active in the apoplast of sink organs,and can be involved in sucrose partitioning, control of cell differentiation and plant development, and responses to wounding and pathogen infection.<ref name="ref1"/>
 +
The cDNA, designated OsCIN1, contains an open reading frame of 1731 bp encoding a polypeptide of 577 amino acid residues. The deduced amino acid sequence showed typical features of the cell wall invertases, including a β-fructosidase motif and a cysteine catalytic site, and shared 78.6 and 73.7% identity with maize cell wall invertases, Incw1 and Incw2, respectively.<ref name="ref2"/>
  
 
===Expression===
 
===Expression===

Revision as of 14:43, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

OsCIN1, a rice CIN gene, is active in developing seeds. OsCIN1 has a critical role during the pre-storage phase, being involved in the proliferation of endosperm cells and longitudinal growth of immature seeds, rather than during the starch-filling phase.Cell-wall invertase (CIN) catalyzes the hydrolysis of sucrose into glucose and fructose for the supply of carbohydrates to sink organs via an apoplastic pathway.CINs are most active in the apoplast of sink organs,and can be involved in sucrose partitioning, control of cell differentiation and plant development, and responses to wounding and pathogen infection.[1] The cDNA, designated OsCIN1, contains an open reading frame of 1731 bp encoding a polypeptide of 577 amino acid residues. The deduced amino acid sequence showed typical features of the cell wall invertases, including a β-fructosidase motif and a cysteine catalytic site, and shared 78.6 and 73.7% identity with maize cell wall invertases, Incw1 and Incw2, respectively.[2]

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. Cho JI, Lee SK, Ko S, Kim HK, Jun SH, Lee YH, Bhoo SH, Lee KW, An G, Hahn TR, Jeon JS.Molecular cloning and expression analysis of the cell-wall invertase gene family in rice (Oryza sativa L.).Plant Cell Rep. 2005 Jun;24(4):225-36.
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2

Structured Information

Gene Name

Os02g0534400

Description

Cell wall invertase (EC 3.2.1.26)

Version

NM_001053569.1 GI:115446508 GeneID:4329561

Length

4704 bp

Definition

Oryza sativa Japonica Group Os02g0534400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:20540408..20545111

Sequence Coding Region

20540467..20540653,20541522..20541530,20542166..20543019,20543200..20543358,20543758..20544005
,20544305..20544395,20544534..20544719

Expression

GEO Profiles:Os02g0534400

Genome Context

<gbrowseImage1> name=NC_008395:20540408..20545111 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:20540408..20545111 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggactcggctcttggcgctcgcgccatggctgctgctgctcctcctgcagctcgccggcgcgtcccatgtcgtccaccggagcctcgaggccgagcaggcgccgagctcggtgccggcctccattgtcagccccctgctcaggacaggataccacttccagcccccgatgaactggatcaacgatccgaacgggccactgtattacaagggatggtaccacctattctaccagtacaaccccaagggagctgtgtggggcaatatcgtgtgggctcactcggtatcacaggacctcatcaactggatagcccttgagccggcaatcaagcccgacatcccctccgaccagtacggttgttggtctggctctgccaccatccttcccgatggcacgccggcgatcctctacactgggatcgaccgccccaacatcaactaccaggtgcagaatatcgcatttcccaagaatgcgtcagacccgctccttcgtgagtgggtcaagccggcctacaacccggtggccacgccggagcctggtatgaacgcaacgcaattccgcgatccgacaacggcctggtacgccgacggtcattggcggatgctcgttggtggcctgaagggggctcgcctcggccttgcctacctctaccggagccgggacttcaagacatgggttcgggccaagcacccactccattcggcgctcactgggatgtgggagtgcccagacttctttccgttgcaagcaccaggtctccaggctggcctcgacacatctgtgccgagcagcaagtacgtgctcaagaacagcctcgatctcacccgttatgactactacacggtgggcatctacaacaaggtgacggagcggtatgtgccggacaaccctgctggcgactaccaccggctccgctatgactacggcaacttctacgcatcaaagaccttcttcgacccggtgaagcaccgccgcatcctgcttgggtgggctaacgagtccgacagcgtcacctacgacaaggcgaagggctgggccggcatccatgcgatcccaagaaaggtatggctggacccgagcgggaagcagcttctgcagtggccaatcgaggagctggagacgctgaggggcaaatcggtcagcgtctttgacaaggtggtgaagcccggggaacatttccaagtcacgggcctcggaacctaccaggctgacgtggaggtgagcttggaggtgtccgggctggagaaggcggaggcgttggacccggcgttcggcgacgacgcggagaggctgtgcggcgcgaagggcgcggacgtgaggggcggcgtggtgttcgggctgtgggtgctggcctccgccggcctggaggagaaaaccgccgtcttcttccgcgtcttcaagccggccgggcacggcgccaagcccgtcgtcctcatgtgcaccgaccctaccaagtcttctcttagcccggatctctacaagccaacttttgccgggttcgtcgacaccgacatctcgtccgggaagatctccttgagaagcttgattgaccgttcggtggttgagagcttcggcgccgggggcaagacctgcatcctgtcgagagtttacccgtcgatggcgataggtgacaaggcccatctttacgtcttcaacaatggggaggcggatattaagatttcacatctgaaagcgtgggaaatgaagaagccgcttatgaatggcgcctaa</cdnaseq>

Protein Sequence

<aaseq>MGTRLLALAPWLLLLLLQLAGASHVVHRSLEAEQAPSSVPASIV SPLLRTGYHFQPPMNWINDPNGPLYYKGWYHLFYQYNPKGAVWGNIVWAHSVSQDLIN WIALEPAIKPDIPSDQYGCWSGSATILPDGTPAILYTGIDRPNINYQVQNIAFPKNAS DPLLREWVKPAYNPVATPEPGMNATQFRDPTTAWYADGHWRMLVGGLKGARLGLAYLY RSRDFKTWVRAKHPLHSALTGMWECPDFFPLQAPGLQAGLDTSVPSSKYVLKNSLDLT RYDYYTVGIYNKVTERYVPDNPAGDYHRLRYDYGNFYASKTFFDPVKHRRILLGWANE SDSVTYDKAKGWAGIHAIPRKVWLDPSGKQLLQWPIEELETLRGKSVSVFDKVVKPGE HFQVTGLGTYQADVEVSLEVSGLEKAEALDPAFGDDAERLCGAKGADVRGGVVFGLWV LASAGLEEKTAVFFRVFKPAGHGAKPVVLMCTDPTKSSLSPDLYKPTFAGFVDTDISS GKISLRSLIDRSVVESFGAGGKTCILSRVYPSMAIGDKAHLYVFNNGEADIKISHLKA WEMKKPLMNGA</aaseq>

Gene Sequence

<dnaseqindica>60..246#1115..1123#1759..2612#2793..2951#3351..3598#3898..3988#4127..4312#catccctttctgcccctcgtcttctccccctccctggccggcctgtctagtacaaaacaatggggactcggctcttggcgctcgcgccatggctgctgctgctcctcctgcagctcgccggcgcgtcccatgtcgtccaccggagcctcgaggccgagcaggcgccgagctcggtgccggcctccattgtcagccccctgctcaggacaggataccacttccagcccccgatgaactggatcaacggtaagcaaagattgtgctcagctagcttctctgaacttttggatgttcttcagttcctctttgtcttggtttcttcgacatcttctcttcaaagcttggtttgttttggtttcttcttatcttcagtattagctatagcttagctttattacataactagtacaagaaaatatcatgccatagacgaacaaagcaatacatggctctgaattttagctgatgtactccctccgtttcagtttataagatgttttggctttggtcaaaatctaactgcttcaaatttgatcaaatttatagaaaataataataatattttaaagccaagataaatttatttaaaaatatatttaattattaatttaataaaactaattttgtaatgtaaatattattatatttgtctataaacttagtaatctgaaacggagggagtatgcaagtagtactttgcaccttggtaaaaaattaaaacagcttctgtggttagtggtttaatctcgtgttaatctacataaccgctggtgatttctggtggacaaaaaaattacagcttgctgagttatcaactttatattggctatgttagttaggtagtcctgcagttgttttcttctccatcagaaaagtcaagctgcaggcttttaagttatcacagtatccgacaacggtgaagacttgcagttcagcaagtacccgaataataatacaccagctttgtttttgagcattaagctaataactcttgattgatacctaattgatgcttgctgcaattatactgttctaactcgatttttttatttctcttcttgtgtctggttctgatcatatcgctgcgactgcaaattaatctcatcgacgacagatccgaacggtacgaattttccggcccacttcttgcaaattatctctgtcttgttctgcctactagatctatgatgttgagagtataatgaacagcaacgcttgtgtgcatgtgttttttaaatatgggaagattaaagaccaattttttagaaggagctaagagaaaggacagtttaacattaaaatggtgcatgccggcacgcacatgctgcaaggcgaatgcgtatatacaacggcctcttgcagtaggcagaaaaatttaagctggtcaagctttcgaagtttggtcttaaaatttgacaatgggatcaatcaacggattcctttggcgtatcactgtctggaagtgaatctcaatttgattatacgaatttagacatgacaagacataatcaatttcacaataaactttaatttaaacaactcatttttgtaaaacagtaaagaaaccatataaaaagtgataagttgataagcaataagttgtacctgtacacaagaatagatctaattaacatgtgtactatgggctcccccccccaacccccacccccaccccaaaaaaaaattgggggatccgccccagttatacatgaaaaatgttttgagcttttgagttgataagttgagaacattgaacagggccactgtattacaagggatggtaccacctattctaccagtacaaccccaagggagctgtgtggggcaatatcgtgtgggctcactcggtatcacaggacctcatcaactggatagcccttgagccggcaatcaagcccgacatcccctccgaccagtacggttgttggtctggctctgccaccatccttcccgatggcacgccggcgatcctctacactgggatcgaccgccccaacatcaactaccaggtgcagaatatcgcatttcccaagaatgcgtcagacccgctccttcgtgagtgggtcaagccggcctacaacccggtggccacgccggagcctggtatgaacgcaacgcaattccgcgatccgacaacggcctggtacgccgacggtcattggcggatgctcgttggtggcctgaagggggctcgcctcggccttgcctacctctaccggagccgggacttcaagacatgggttcgggccaagcacccactccattcggcgctcactgggatgtgggagtgcccagacttctttccgttgcaagcaccaggtctccaggctggcctcgacacatctgtgccgagcagcaagtacgtgctcaagaacagcctcgatctcacccgttatgactactacacggtgggcatctacaacaaggtgacggagcggtatgtgccggacaaccctgctggcgactaccaccggctccgctatgactacggcaacttctacgcatcaaagaccttcttcgacccggtgaagcaccgccgcatcctgcttgggtgggctaacgagtccgacagcgtcacctacgacaaggcgaagggctgggccggcatccatgtaaatcatagttacaattttgcaatcctaatttcttgtactacctacctccacaaatgtttgatgttattagttatcttaatttcaagagctaaccaaacgtaaaagaaaaattggagggactagaggtttaattagaattgatttggagattgatggcttggcttgtgtcgttggcaggcgatcccaagaaaggtatggctggacccgagcgggaagcagcttctgcagtggccaatcgaggagctggagacgctgaggggcaaatcggtcagcgtctttgacaaggtggtgaagcccggggaacatttccaagtcacgggcctcggaacctaccaggttgctacactacaaaatcaaaaaccagtaacttgaaatttccatccacaagaaaatgagactagaatattggccatatatattgctgccgtcaagggccccatgtgcaggagcttcctagttatacggagtactagctaagctcgctccggtccaattccgtatgggcagcgatcatcgcgtgcccaattcctgctcgtgcacgcgaagatcgcgaagtcgccggaccggcgatttttccgctcggtcggcgtcagcttccgctcccgcccgtttcaccttcaacggcgtggacgcatccggttggccggagaggaacctgcaacgcatcgcatattcgccttctaggtgtgacgctgacgcttacaagttttgctttgatatttgtgtgtcgatcaggctgacgtggaggtgagcttggaggtgtccgggctggagaaggcggaggcgttggacccggcgttcggcgacgacgcggagaggctgtgcggcgcgaagggcgcggacgtgaggggcggcgtggtgttcgggctgtgggtgctggcctccgccggcctggaggagaaaaccgccgtcttcttccgcgtcttcaagccggccgggcacggcgccaagcccgtcgtcctcatgtgcaccgaccctaccaagtacgataccactaccagccaaatctatactactaccttgtgatgtctcggtacaatgcaagcagcacacatgcatatacccatcctgcatgcactgatcaatgtctgccacgttttcaaaaaaaaaatgagagaagaaatacatgatcttagagttggaatcacacaccctttatcacagcactatcaaatacgtctcctgtcacattttcgcaattacccaaacacagtagacaacttaaaatgctaaatccaaagctctgaagttgattaattactgtcctttttttattgagcaggtcttctcttagcccggatctctacaagccaacttttgccgggttcgtcgacaccgacatctcgtccgggaagatctccttgagaagcttggtatagtacacacatatactacgagcttaattaaccacgttttttattagtgcctctcgtatataacttaccaatgctttattgactgtgaccatgattagtcttatatatgcatcattgtttgtgacttcgtttcagattgaccgttcggtggttgagagcttcggcgccgggggcaagacctgcatcctgtcgagagtttacccgtcgatggcgataggtgacaaggcccatctttacgtcttcaacaatggggaggcggatattaagatttcacatctgaaagcgtgggaaatgaagaagccgcttatgaatggcgcctaattaatttgccgcggatatatatgatggcgactttaattaattgctattattaaatcatcactcgccatctgcgatataccggccagatcgtccctgacatcgatctcctgttcttggccgatgttgcacgctgcacgatatttgattgcttgttgctgaggatgattggagtttgtattcgtgtctccagatatcgaaagaccagggtaattttacactcttcttgtacaattaattgattgtatcacgagttgtttgtaaacaattgtttgtatcacgagttgtttgcaaacatttgtttgtaccacgatcgagttgtgtgacaaataaattaagatgctgattatttcatcatgttacagataataaagaggttttccgtgatttacttc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0534400, RefSeq:Os02g0534400