Difference between revisions of "Os09g0452200"

From RiceWiki
Jump to: navigation, search
(Function)
(Annotated Information)
Line 11: Line 11:
 
'''Rice LYP4 and LYP6 Are LysM-Containing Proteins Localized at the Plasma Membrane'''
 
'''Rice LYP4 and LYP6 Are LysM-Containing Proteins Localized at the Plasma Membrane'''
 
<br/>
 
<br/>
 +
Bioinformatic analysis predicted that LYP4 and LYP6 both have an N-terminal signal peptide, two characteristic LysMs, and a putative C-terminal glycosylphosphatidylinositol (GPI) anchor signal sequence. All characterized homologs of LYP4 and LYP6 have been verified as plasma membrane proteins. <ref name="ref1"/>
 +
<br/>
  
 
===Expression===
 
===Expression===
Please input expression information here.
+
''LYP4'' and ''LYP6'' were most abundantly expressed in rice callus cells, and both transcripts progressively decreased during maturation (Figure 1D). Furthermore, analysis of ''LYP4'' and ''LYP6'' expression patterns in ''Promoter:GUS''(for b-glucuronidase) transgenic rice demonstrated strong GUS staining in young seedlings, particularly in the root meristem region and the lateral root primordium (see Supplemental Figure 2 online), resembling the expression patterns of their orthologLYM1 in ''M. truncatula''(Fliegmann et al., 2011). Interestingly, expression ofLYP4andLYP6in rice seedlings, mature leaves, and roots could be quickly induced upon exposure to the rice bacterial pathogen ''Xanthomonas oryzae'' pv ''oryzae''.<ref name="ref1"/>
 
+
----
 +
[[File:Figure_1.LysM-Containing_LYP4_and_LYP6_Are_Rice_Plasma_Membrane_Proteins.png|thumb|Figure 1]]
 +
[[File:Fig_2.png|thumb|Figure 2]]
 
===Evolution===
 
===Evolution===
 
Please input evolution information here.
 
Please input evolution information here.
  
You can also add sub-section(s) at will.
+
You can also add sub-section#s# at will.
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 03:26, 7 June 2014

This gene is named as LYP4.

Annotated Information

Function

    This gene's sign is LYP4 which function is encoding peptidoglycan(PGN) and chitin oligosaccharide elicitor-binding protein. LYP4 and LYP6 are dual function receptors sensing both bacterial PGN and fungal chitin in rice innate immunity. in vitro ligand binding assays demonstrated that these proteins could not only bind to PGN but also to chitin. Silencing of either LYPgene significantly compromised PGN- and chitin-induced defense responses in rice, leading to increased susceptibility to both bacterial and fungal pathogens.


Rice LYP4 and LYP6 Are LysM-Containing Proteins Localized at the Plasma Membrane
Bioinformatic analysis predicted that LYP4 and LYP6 both have an N-terminal signal peptide, two characteristic LysMs, and a putative C-terminal glycosylphosphatidylinositol (GPI) anchor signal sequence. All characterized homologs of LYP4 and LYP6 have been verified as plasma membrane proteins. [1]

Expression

LYP4 and LYP6 were most abundantly expressed in rice callus cells, and both transcripts progressively decreased during maturation (Figure 1D). Furthermore, analysis of LYP4 and LYP6 expression patterns in Promoter:GUS(for b-glucuronidase) transgenic rice demonstrated strong GUS staining in young seedlings, particularly in the root meristem region and the lateral root primordium (see Supplemental Figure 2 online), resembling the expression patterns of their orthologLYM1 in M. truncatula(Fliegmann et al., 2011). Interestingly, expression ofLYP4andLYP6in rice seedlings, mature leaves, and roots could be quickly induced upon exposure to the rice bacterial pathogen Xanthomonas oryzae pv oryzae.[1]


Figure 1
Figure 2

Evolution

Please input evolution information here.

You can also add sub-section#s# at will.

Labs working on this gene

State Key Laboratory of Biocontrol,Key Laboratory of Gene Engineering of the Ministry of Education, Guangdong Key Laboratory of Plant Resources, School of Life Sciences, Sun Yat-sen University

References

Bing Liu;Jian-Feng Li;Ying Ao;Jinwang Qu;Zhangqun Li;Jianbin Su;Yang Zhang;Jun Liu;Dongru Feng;Kangbiao Qi;Yanming He;Jinfa Wang;Hong-Bin Wang. Lysin Motif–Containing Proteins LYP4 and LYP6 Play Dual Roles in Peptidoglycan and Chitin Perception in Rice Innate Immunity. The Plant Cell, 2012, 24(8): 3406-3419. fullText

Structured Information

Gene Name

Os09g0452200

Description

Similar to LysM-domain GPI-anchored protein 1 precursor. Splice isoform 2

Version

NM_001069870.1 GI:115479482 GeneID:4347230

Length

3597 bp

Definition

Oryza sativa Japonica Group Os09g0452200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:17612255..17615851

Sequence Coding Region

17612437..17613100,17614647..17614764,17614895..17615059,17615173..17615204,17615292..17615518

Expression

GEO Profiles:Os09g0452200

Genome Context

<gbrowseImage1> name=NC_008402:17612255..17615851 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:17612255..17615851 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccaccacccttgctcctcctcctcctcctcgccgccgccgccgccgccgtcgcgcccgcgcggtccaagtcgacgctggagtcctgctcctcttccaccgcctgcccagcgctgctctcctacacgctctacgccgacctcaagctcgccgagctggccgcgctcttctccgccgacccgctcgccatcctcgccgccaactccatcgacttcgccgtcccggaccccgccgaccgcatcctccccgcggggctcccgctccgcgtgcccgtcccctgcgcctgctccgacggcatccgcagggtcaccaccgtgcgctacgttgcgcgcccgggcgacacgctcgcctccgtcgcctcctccgtctacggcggcctcaccaccccggactggatcagcgactccaacggcatcctcggcgccaagcccgacgccgccgtcgacgccgggacgactctgttcgtgccgctgcactgcgcctgcttcggcggcgtcgacaacggcctccccgcggtgtacctcacgtacgtcgccgggaagggggacaccgtcgccgcagtcgcgcagaggtaccggaccacggccaccgacctcatgagcgtcaacgacatggccacccccgagctcgccgccggtgacatcatcgtcgtcccgctgccagcgtgcacatcatcattcccggcgttcacggcggactacggcctggcggtggcgaacgggacctacgcagttactgccaaccggtgtgtccagtgcagctgtggcccaggcaacttggacctgttctgcgtgccggcgccgctcgccgactcgacgtgctccagcatgcagtgcgccaacagcagcatgatgctcggcaacttcactctcctcatgaccagctccggctgcagcgtcacgtcctgcagctacggcggattcgtgaacggcacaattctcaccacgttaaccacagcactcaagcctcaatgcccaggtccgcatcagtatcctccgctgattccgccgccgacgtcgtccttcttcgagacgtacctcggcccttcgccgacgccgatggcatccgaaggaggcgtcatggccggcatggcgccgacgagcaccccggcggcgagctccggccctcctccggccggccggcacgtcgtcggcgacgttcttggggcgttcgctctctgcctcgtcggcaacctgctgtggtaa</cdnaseq>

Protein Sequence

<aaseq>MPPPLLLLLLLAAAAAAVAPARSKSTLESCSSSTACPALLSYTL YADLKLAELAALFSADPLAILAANSIDFAVPDPADRILPAGLPLRVPVPCACSDGIRR VTTVRYVARPGDTLASVASSVYGGLTTPDWISDSNGILGAKPDAAVDAGTTLFVPLHC ACFGGVDNGLPAVYLTYVAGKGDTVAAVAQRYRTTATDLMSVNDMATPELAAGDIIVV PLPACTSSFPAFTADYGLAVANGTYAVTANRCVQCSCGPGNLDLFCVPAPLADSTCSS MQCANSSMMLGNFTLLMTSSGCSVTSCSYGGFVNGTILTTLTTALKPQCPGPHQYPPL IPPPTSSFFETYLGPSPTPMASEGGVMAGMAPTSTPAASSGPPPAGRHVVGDVLGAFA LCLVGNLLW</aaseq>

Gene Sequence

<dnaseqindica>183..846#2393..2510#2641..2805#2919..2950#3038..3264#atgtgatcccaggtctgcagttctgcacagccgaacacaagatccaaaaccccccgcacgctttccaaagcaaagcactctctcgacatcgccccactccaggtcaacagtctccactctcactggctcgcagtcgcacacactcccacgcctccgcgctcccgaccaccgtcgccatcatcatgccaccacccttgctcctcctcctcctcctcgccgccgccgccgccgccgtcgcgcccgcgcggtccaagtcgacgctggagtcctgctcctcttccaccgcctgcccagcgctgctctcctacacgctctacgccgacctcaagctcgccgagctggccgcgctcttctccgccgacccgctcgccatcctcgccgccaactccatcgacttcgccgtcccggaccccgccgaccgcatcctccccgcggggctcccgctccgcgtgcccgtcccctgcgcctgctccgacggcatccgcagggtcaccaccgtgcgctacgttgcgcgcccgggcgacacgctcgcctccgtcgcctcctccgtctacggcggcctcaccaccccggactggatcagcgactccaacggcatcctcggcgccaagcccgacgccgccgtcgacgccgggacgactctgttcgtgccgctgcactgcgcctgcttcggcggcgtcgacaacggcctccccgcggtgtacctcacgtacgtcgccgggaagggggacaccgtcgccgcagtcgcgcagaggtaccggaccacggccaccgacctcatgagcgtcaacgacatggccacccccgagctcgccgccggtgacatcatcgtcgtcccgctgccaggtgagcccttttctagcttcaattcatagcttcttcttggatctggtagtttttggttttgttgctttgtgctaccgagatgtattgcgtggttcgttggtaattagatccatggccatgggtggttaaccgacaaatttggttggtaattttactccatactcagtaagaagtagcagtaggagtactatactgacagtaatgtgattagtctagtgtgtccttggtaatttagtgcaatgcagtaaccgcactggccacaagccttgctactgcgagcatgagatttactccgaattctggatacgggcatgtgcagatttgtagtactagaatgcgtctaatccgatcctaagttgctatattttgggacggagggagtatctagctttgatatcagaaaggccatgtttagttcctatgcaaaaactttttatcctgtcatatcgaatatttagacatatacatggagaattaaatatagataaaaaaactaattacacagattgcgtgtaattgtgagatgaatcttttaagcctaattgcgctatgatttgataatgtggtgctacagtaaatatgtgctaatgatgaattaattaggcttaataaatttgtctcgcagtttacaggcggaatctataatttatttttttattagattacgtttaatactttaagtctatgtccatatatccgatgtaacacgccaaaacttttcatcctgtaactaaacagggccaaaatgcttcaagattcgtgaggtgaaacatgagtgccagcaatgcagcgcatcactgcttgtctgctcaaattgtttactagtgccagttcggatgctctgtttgtgtatctgcacgtactggcgctctcagctttaaaataaaagggtccatgcatgaaactttacctttccactgctccttttgatcatttgctgtcaattaagctgacacccaagaaaaggagatgaaaaaaaaggtgtagcatgcagcacgattgcacgacataaatttgacaattaagaatgttcaacacaaacttagagagactttaatttcactattgtgagaaagaaagtgttgtgtcgttttctctgttgtgaatagctgaaaggtcttctagagttcttaagtgcgatccatgtgtgatgcattgaaaaaattaacgattttcatttgtgcacatagattcagcactgaaaagctgtgctgttttcctgtttcctaaaaggaggttggtaaacaaactaaacactctgctctgagtttctagaccgaattgtagttccgataatttctgaagggaagtggccaaaagtttcaatcccctccatacccagatgttctgtcagatcacggacaaacaggattctatcataattaatcagtggccactacaatagccagtacctagctacagttagtacatgattggtccatttcgtcctcgtcgtcactgttatccctataccgttttctgcttcatttatctcacatgcaattaatcatgacggagtaccattttttttctctcgaacatgcagcgtgcacatcatcattcccggcgttcacggcggactacggcctggcggtggcgaacgggacctacgcagttactgccaaccggtgtgtccagtgcagctgtggcccaggcaacttggagtaggcaccgatcgatttcaccctcccatcttcaatctgctccagatcttacgcgaaccgagagatttctctcctgtttctgacgctgccgttgcccgttgctttgcttgcttttgctctgctgttgcagcctgttctgcgtgccggcgccgctcgccgactcgacgtgctccagcatgcagtgcgccaacagcagcatgatgctcggcaacttcactctcctcatgaccagctccggctgcagcgtcacgtcctgcagctacggcggattcgtgaacggcacaattctcaccacgtaattgatcagcttttttttttttgtgtgtgtgtgtgtcccaaatccatctcgcattttgctattcagaaaccgttgtctcaccgtagcgatacattttgtgcatctttcaggttaaccacagcactcaagcctcaatgcccaggtataaaattcgtgctcaattatgtctcagttcaccatttctgccttgaaaaaccgagactttatgcagctcttgcttttcgtgcaggtccgcatcagtatcctccgctgattccgccgccgacgtcgtccttcttcgagacgtacctcggcccttcgccgacgccgatggcatccgaaggaggcgtcatggccggcatggcgccgacgagcaccccggcggcgagctccggccctcctccggccggccggcacgtcgtcggcgacgttcttggggcgttcgctctctgcctcgtcggcaacctgctgtggtaacagagcggctctcgccgttgatgctacataattttgtacagaagctgtggccggctgtgtttttgtcgggcagcgtcgggttgtgcccaatttttgttgcgttcattcgatttgtctgccactcactcctgtggaatggcaaacacaattacagaagcgcagatctctccagcgcggctgtaatggtcctgaattcctgatgctattgagaatgtgagtaccgagtagtgtgctttttatcgacgctttttactgtaccttctactactgatatgctttttagggcacccacaatggttatttataaactctctacaggagattcatatcagc</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0452200, RefSeq:Os09g0452200

  1. 1.0 1.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref1