Difference between revisions of "Os01g0785400"

From RiceWiki
Jump to: navigation, search
(Genomic organization and chromosomal distribution)
(Genomic organization and chromosomal distribution)
Line 10: Line 10:
  
 
===Genomic organization and chromosomal distribution===
 
===Genomic organization and chromosomal distribution===
1.Coding sequences of OsGH3 genes are disrupted by one to four introns except for OsGH3-6 and -9, which do not harbor any intron. Although the exon–intron organization of OsGH3 genes in terms of their numbers does not seem to be very similar, their intron phasing is highly conserved, which is indicative of exon shuffling.(Fig.1)
+
1.Exon–intron organization of rice GH3 genes.Coding sequences of OsGH3 genes are disrupted by one to four introns except for OsGH3-6 and -9, which do not harbor any intron. Although the exon–intron organization of OsGH3 genes in terms of their numbers does not seem to be very similar, their intron phasing is highly conserved, which is indicative of exon shuffling.(Fig.1)
[[File:SilenceMads29.jpg|right|thumb|250px|'''Figure 1.''' ''Exon–intron organization of rice GH3 genes (from reference<ref name="ref1" />).'']]
+
[[File:Exon–intron organization of rice GH3 genes.jpg|right|thumb|250px|'''Figure 1.''' ''Exon–intron organization of rice GH3 genes (from reference<ref name="ref2" />).'']]
  
 
2.Genomic distribution of GH3 genes on rice chromosomes. White ovals on the chromosomes (vertical bars) indicate the position of centromeres. The arrows next to gene names show the direction of transcription. The numbers in parentheses designate the position of the first exon of corresponding GH3 gene in megabases (Mb) on rice chromosome pseudomolecules available at TIGR (release 3). The chromosome numbers are indicated at the top of each bar.(Fig.2)
 
2.Genomic distribution of GH3 genes on rice chromosomes. White ovals on the chromosomes (vertical bars) indicate the position of centromeres. The arrows next to gene names show the direction of transcription. The numbers in parentheses designate the position of the first exon of corresponding GH3 gene in megabases (Mb) on rice chromosome pseudomolecules available at TIGR (release 3). The chromosome numbers are indicated at the top of each bar.(Fig.2)

Revision as of 16:22, 6 June 2014

Please input one-sentence summary here.

Annotated Information

Function

GH3 is one kind of early auxin-responsive genes that widely exists in numerous plants. GH3 belongs to the luciferase superfamily and contains highly conserved regions and variable regions. The GH3 proteins are classified into three groups on the basis of the protein structure and function, and group II GH3 genes encode IAA–amido synthetases, which help to maintain auxin homeostasis by conjugating excess IAA to amino acids. Previous studies showed that the GH3 proteins in Arabidopsis modulate multiple developmental processes including photo-morphogenesis, light and auxin signaling, and auxin homeostasis. In rice, GH3 proteins have been structurally analyzed and studies showed that OsGH3-2 participates in the microRNA-mediated auxin signal transduction pathway, OsGH3-8 maintains auxin homeostasis and functions in basal disease resistance, and OsGH3-13 regulates plant architecture and drought tolerance.[1]

Gene Family

The information on rice genomic sequence provides a powerful tool to identify putative homologous proteins by database searches with genes of known function from other organisms. The overall analysis of the complete genome of rice revealed that auxin-inducible GH3 gene family is comprised of 12 members(Table1). However, in A. thaliana, 19 GH3 genes, along with an additional partial gene (coding only for amino terminal third of the protein), have been reported. GH3 gene family in rice.jpg

Genomic organization and chromosomal distribution

1.Exon–intron organization of rice GH3 genes.Coding sequences of OsGH3 genes are disrupted by one to four introns except for OsGH3-6 and -9, which do not harbor any intron. Although the exon–intron organization of OsGH3 genes in terms of their numbers does not seem to be very similar, their intron phasing is highly conserved, which is indicative of exon shuffling.(Fig.1)

Figure 1. Exon–intron organization of rice GH3 genes (from reference[2]).

2.Genomic distribution of GH3 genes on rice chromosomes. White ovals on the chromosomes (vertical bars) indicate the position of centromeres. The arrows next to gene names show the direction of transcription. The numbers in parentheses designate the position of the first exon of corresponding GH3 gene in megabases (Mb) on rice chromosome pseudomolecules available at TIGR (release 3). The chromosome numbers are indicated at the top of each bar.(Fig.2)

Expression

Please input expression information here.

Overexpression

Please input overexpression information here.

Mutation

Please input mutation information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. Zhao S Q, Xiang J J, Xue H W. Studies on the Rice Leaf INCLINATION1 (LC1), an IAA–amido Synthetase, Reveal the Effects of Auxin in Leaf Inclination Control[J]. Molecular plant, 2013, 6(1): 174-187.
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2

Structured Information

Gene Name

Os01g0785400

Description

GH3 auxin-responsive promoter family protein

Version

NM_001051002.1 GI:115440374 GeneID:4327043

Length

2486 bp

Definition

Oryza sativa Japonica Group Os01g0785400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:35064294..35066779

Sequence Coding Region

35064438..35064763,35064906..35065804,35065915..35066522

Expression

GEO Profiles:Os01g0785400

Genome Context

<gbrowseImage1> name=NC_008394:35064294..35066779 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:35064294..35066779 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccggaagcaccgaccgccaagacagcaccggcctacggctacgcccccggggcgcacgccgaggcgctcgagttcatcgagcacgtcacggcgaacgccgggcaggtgcagcggcgcgtgctcggcgagatcctggcgcagaacgcgccggccgagtacctgcgccggtacggaatccccgggtcccccgacgttgtcgacgccttccgccgcctcgtcccgctcgtcacatacgagggcctccagccagacatcctccgcatcgccaacggcgacacctcgccgatcttctccgggaagcctatctccgaattcctcacgagctcgggcacgtcgggaggggagaggaagctcatgccgaccatcgccgacgagatgaacaggcggtcgctgctgtacagcctgctgatgccggtgatgagccagtcggtgtccgggctcgacaaaggcaaggcgatgtacctgctcttcgtgaaggcggagtcgcgcacgccgggcgggctcgcggcgcggccggtgctcacaagctactaccggagccggcagttcctcgaccgtccgcgcgacccctacacatcttacacgagccccgacgaggccatcctgtgcgtggactcctaccagagcatgtacgcgcagctgctctgcggcctcgtccaccgcgccgacgtgctgcgcgtgggcgccgtgttcgcctccggcttcctccgcgccatccatttcctcgagaagcactgggcgcgcctctgccacgacatccgcaccggcgagctcgacccggagatcaccgaccgcgtggtgcgcgacgccgtcgggcgggtgctccgcgccgacccggcgctcgccgacgcgatcgaggacgagtgcgctagggcgtcgtgggagggcatcatccggcgcctgtggccacgcaccaagtacatcgacgtgatcgtgaccggcaccatgtcgcagtacatcccgacgctcgagttctacggcggcggcctgccgctgacgtgcaccatgtacgcctcttcggagtgctacttcggcctcaacctgaatcccatgtgcaagcccagcgacgtcgcctacacgctcatccccaccatgtgctactacgagttcctccccgtcaattgcaacaatgccactgccgaggcgagccaccgcgacctcgtcgacctggtcgacgtaaagctcgggcacgagtacgagctcgtggtcaccacgtattccgggttgtatcgttatcgcgtgggcgacgtgctgagggtggcggggttcaagaacaaggccccgatgttcagcttcgtgcggcggcagaacgtggcgctgagcgtcgactcggacaagacggacgagacggagctgcacgcggcggtgagcggcgcggtgcagcacctggcgccgttcggcgcgtcgctggtggagtacacgagctacgcggacgcggccaccatcccgggccactacgtgctgttctgggagctgcgcgccggcagcacggcggtgccggcgtccgtgttcgaggagtgctgcctgtccgtggaggaggcactgaacagcgtctaccggcagggccgcgcgtgcgacaggtccatcggcccgctcgagatacgcgtcgtggcggagggcaccttcgacaagctcatggactacgcgatcagccggggcgcgtccatcaaccagtacaaggcgccgcggtgcgtgcgccctggcccggtcgtcgagctgctcgacgcgagggtgcagggcaagtacttcagtcccaagtgccccaagtggagccccgggaacaagcaatggaacaaaagcaaggatctggtcggcaagggagacgcctaa</cdnaseq>

Protein Sequence

<aaseq>MPEAPTAKTAPAYGYAPGAHAEALEFIEHVTANAGQVQRRVLGE ILAQNAPAEYLRRYGIPGSPDVVDAFRRLVPLVTYEGLQPDILRIANGDTSPIFSGKP ISEFLTSSGTSGGERKLMPTIADEMNRRSLLYSLLMPVMSQSVSGLDKGKAMYLLFVK AESRTPGGLAARPVLTSYYRSRQFLDRPRDPYTSYTSPDEAILCVDSYQSMYAQLLCG LVHRADVLRVGAVFASGFLRAIHFLEKHWARLCHDIRTGELDPEITDRVVRDAVGRVL RADPALADAIEDECARASWEGIIRRLWPRTKYIDVIVTGTMSQYIPTLEFYGGGLPLT CTMYASSECYFGLNLNPMCKPSDVAYTLIPTMCYYEFLPVNCNNATAEASHRDLVDLV DVKLGHEYELVVTTYSGLYRYRVGDVLRVAGFKNKAPMFSFVRRQNVALSVDSDKTDE TELHAAVSGAVQHLAPFGASLVEYTSYADAATIPGHYVLFWELRAGSTAVPASVFEEC CLSVEEALNSVYRQGRACDRSIGPLEIRVVAEGTFDKLMDYAISRGASINQYKAPRCV RPGPVVELLDARVQGKYFSPKCPKWSPGNKQWNKSKDLVGKGDA</aaseq>

Gene Sequence

<dnaseqindica>145..470#613..1511#1622..2229#cacaaaccaagctccataccgctgcctacatctctggttagtagccaccaaggtccaaggagtaacacgctccgtgagagaccgaaatccagggagcacaaattgcacatttgcaccaagcacactcgctgcagctgcagtgacatgccggaagcaccgaccgccaagacagcaccggcctacggctacgcccccggggcgcacgccgaggcgctcgagttcatcgagcacgtcacggcgaacgccgggcaggtgcagcggcgcgtgctcggcgagatcctggcgcagaacgcgccggccgagtacctgcgccggtacggaatccccgggtcccccgacgttgtcgacgccttccgccgcctcgtcccgctcgtcacatacgagggcctccagccagacatcctccgcatcgccaacggcgacacctcgccgatcttctccgggaagcctatctccgaattcctcacgaggtatagcacaatatataacgtgacatgttcatgcttccccgtgtgtgtacgcacgcacgctgctgcgtgcaaaacctagaaagacgtacgagttcatatctgtacagatcttcatgcaatggaatttcatcatgtccaccagctcgggcacgtcgggaggggagaggaagctcatgccgaccatcgccgacgagatgaacaggcggtcgctgctgtacagcctgctgatgccggtgatgagccagtcggtgtccgggctcgacaaaggcaaggcgatgtacctgctcttcgtgaaggcggagtcgcgcacgccgggcgggctcgcggcgcggccggtgctcacaagctactaccggagccggcagttcctcgaccgtccgcgcgacccctacacatcttacacgagccccgacgaggccatcctgtgcgtggactcctaccagagcatgtacgcgcagctgctctgcggcctcgtccaccgcgccgacgtgctgcgcgtgggcgccgtgttcgcctccggcttcctccgcgccatccatttcctcgagaagcactgggcgcgcctctgccacgacatccgcaccggcgagctcgacccggagatcaccgaccgcgtggtgcgcgacgccgtcgggcgggtgctccgcgccgacccggcgctcgccgacgcgatcgaggacgagtgcgctagggcgtcgtgggagggcatcatccggcgcctgtggccacgcaccaagtacatcgacgtgatcgtgaccggcaccatgtcgcagtacatcccgacgctcgagttctacggcggcggcctgccgctgacgtgcaccatgtacgcctcttcggagtgctacttcggcctcaacctgaatcccatgtgcaagcccagcgacgtcgcctacacgctcatccccaccatgtgctactacgagttcctccccgtcaattgcaacaatgccactgccgaggcgagccaccgcgacctcgtcgacctggtcgacgtaaagctcgggcacgagtacgagctcgtggtcaccacgtattccggtaaatctgccttacctcttcgacacataacgtggccgcgcgcgatggatgatatatattcttatatgcagtagtaatatatataattaacagttttgcgattgtgacagggttgtatcgttatcgcgtgggcgacgtgctgagggtggcggggttcaagaacaaggccccgatgttcagcttcgtgcggcggcagaacgtggcgctgagcgtcgactcggacaagacggacgagacggagctgcacgcggcggtgagcggcgcggtgcagcacctggcgccgttcggcgcgtcgctggtggagtacacgagctacgcggacgcggccaccatcccgggccactacgtgctgttctgggagctgcgcgccggcagcacggcggtgccggcgtccgtgttcgaggagtgctgcctgtccgtggaggaggcactgaacagcgtctaccggcagggccgcgcgtgcgacaggtccatcggcccgctcgagatacgcgtcgtggcggagggcaccttcgacaagctcatggactacgcgatcagccggggcgcgtccatcaaccagtacaaggcgccgcggtgcgtgcgccctggcccggtcgtcgagctgctcgacgcgagggtgcagggcaagtacttcagtcccaagtgccccaagtggagccccgggaacaagcaatggaacaaaagcaaggatctggtcggcaagggagacgcctaatattgaagctagagggtgatgatctgatcgagtatttgtgtgagctggtaattaattaacggtacatgcatatggtcattggtcgatatgtttctttagggatatgataattcatgtttgaattatctctgatgctgcgagaggatcgaatagttatgagatgacgacttagcctatatgatcatttgctttactctttctctgctgtaacgcagtatatgttatttcctccgtctcaaaatataagcatttttagt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0785400, RefSeq:Os01g0785400