Difference between revisions of "Os03g0666200"

From RiceWiki
Jump to: navigation, search
(Evolution)
(Evolution)
Line 8: Line 8:
  
 
===Evolution===
 
===Evolution===
SWAP70 protein possessed a PH domain at the N-terminus of the putative DH domain, a characteristic of human SWAP70 Rho GEF (Shinohara et al., 2002). Both the putative PH and DH domains had 22% identity and 64% similarity to human SWAP70 (Figure 1,2). The PH domain contained four basic amino acids conserved in the PH domains of animal SWAP70 proteins, which are critical for binding to phosphatidylinositol 3,4,5-triphosphate (PIP3) (Oka et al., 2007). We also found an additional SWAP70 homologous gene (Os07g0138100) in rice by a BLAST search. Therefore, Os03g0666200 and Os07g0138100 were named OsSWAP70A and OsSWAP70B, respectively. OsSWAP70A and OsSWAP70B shared 64.2% identity (data not shown). A BLAST-based search for plant SWAP70 indicated that maize and sorghum have two genes, and there is one gene in Arabidopsis, ''Vitis vinifera'', ''Ricinus communis'', and ''Populus trichocarpa'' (Figure 3), suggesting that the SWAP70 homologs are conserved in the plant kingdom.
+
SWAP70 protein possessed a PH domain at the N-terminus of the putative DH domain, a characteristic of human SWAP70 Rho GEF (Shinohara et al., 2002). Both the putative PH and DH domains had 22% identity and 64% similarity to human SWAP70 (Figure 1,2).  
 
[[File:B.png|right|thumb|'''Figure 1.'''Comparison of amino acid sequence between the PH domains of OsSWAP70A and human SWAP70. The PH domain of human SWAP70
 
[[File:B.png|right|thumb|'''Figure 1.'''Comparison of amino acid sequence between the PH domains of OsSWAP70A and human SWAP70. The PH domain of human SWAP70
 
(GeneBank accession number NP_055870) was aligned with the predicted PH domain of OsSWAP70A using ClustalW (http://www.ddbj.nig.ac.jp). Identical and similar amino acid residues are indicated by vertical bars and dots, respectively. Shaded boxes indicate 3,4,5-triphosphate (PIP3)-binding sites.]]
 
(GeneBank accession number NP_055870) was aligned with the predicted PH domain of OsSWAP70A using ClustalW (http://www.ddbj.nig.ac.jp). Identical and similar amino acid residues are indicated by vertical bars and dots, respectively. Shaded boxes indicate 3,4,5-triphosphate (PIP3)-binding sites.]]
 +
The PH domain contained four basic amino acids conserved in the PH domains of animal SWAP70 proteins, which are critical for binding to phosphatidylinositol 3,4,5-triphosphate (PIP3) (Oka et al., 2007). We also found an additional SWAP70 homologous gene (Os07g0138100) in rice by a BLAST search. Therefore, Os03g0666200 and Os07g0138100 were named OsSWAP70A and OsSWAP70B, respectively. OsSWAP70A and OsSWAP70B shared 64.2% identity (data not shown). A BLAST-based search for plant SWAP70 indicated that maize and sorghum have two genes, and there is one gene in Arabidopsis, ''Vitis vinifera'', ''Ricinus communis'', and ''Populus trichocarpa'' (Figure 3), suggesting that the SWAP70 homologs are conserved in the plant kingdom.
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 01:18, 7 June 2014

SWAP-70, an unusual phosphatidylinositol-3-kinase-dependent protein that interacts with the RhoGTPase Rac.

Annotated Information

Function

SWAP70 has been shown to exhibit GEF activities toward Cdc42, Rac, and Rho. In the present study, we found that rice [Oryza sativa (Os)] SWAP70 interacted with OsRac1 and the DH domain exhibited GEF activity toward OsRac1 in vitro, evidence that plants possess a functional DH domain. In addition, OsSWAP70 regulates chitin-induced ROS production and defense gene expression in rice. Thus, it is likely that SWAP70 functions as a GEF for Rac/Rop GTPases in rice.

Expression

Please input expression information here.

Evolution

SWAP70 protein possessed a PH domain at the N-terminus of the putative DH domain, a characteristic of human SWAP70 Rho GEF (Shinohara et al., 2002). Both the putative PH and DH domains had 22% identity and 64% similarity to human SWAP70 (Figure 1,2).

Figure 1.Comparison of amino acid sequence between the PH domains of OsSWAP70A and human SWAP70. The PH domain of human SWAP70 (GeneBank accession number NP_055870) was aligned with the predicted PH domain of OsSWAP70A using ClustalW (http://www.ddbj.nig.ac.jp). Identical and similar amino acid residues are indicated by vertical bars and dots, respectively. Shaded boxes indicate 3,4,5-triphosphate (PIP3)-binding sites.

The PH domain contained four basic amino acids conserved in the PH domains of animal SWAP70 proteins, which are critical for binding to phosphatidylinositol 3,4,5-triphosphate (PIP3) (Oka et al., 2007). We also found an additional SWAP70 homologous gene (Os07g0138100) in rice by a BLAST search. Therefore, Os03g0666200 and Os07g0138100 were named OsSWAP70A and OsSWAP70B, respectively. OsSWAP70A and OsSWAP70B shared 64.2% identity (data not shown). A BLAST-based search for plant SWAP70 indicated that maize and sorghum have two genes, and there is one gene in Arabidopsis, Vitis vinifera, Ricinus communis, and Populus trichocarpa (Figure 3), suggesting that the SWAP70 homologs are conserved in the plant kingdom.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os03g0666200

Description

Pleckstrin homology-type domain containing protein

Version

NM_001057380.1 GI:115454488 GeneID:4333661

Length

3925 bp

Definition

Oryza sativa Japonica Group Os03g0666200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:26968125..26972049

Sequence Coding Region

26968410..26968770,26968898..26969190,26969267..26969494,26970120..26970351,26970574..26970655
,26970734..26970765,26970846..26970929,26971016..26971077,26971717..26971821
,26971912..26971935

Expression

GEO Profiles:Os03g0666200

Genome Context

<gbrowseImage1> name=NC_008396:26968125..26972049 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:26968125..26972049 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccaccaacggcagctccccgagggcgagggagactgagagcagcctggagaaggtgaagcggcagctctcgtcggggtccgggcggtacctgctgcaggggccactgctgaagcgatctgagacgttgaggaaatggaatgagagatgggtaattttagaccctacttcaggaaagatggaatacaaaattcggagaaatgaaactgccattaaaggaaccattatatttgatgcttcaagcactattaccttgtcccctgtaaatttccaagggatgccaaagtatgatggctgctgtttctacattggaactcctcaaaaaaaggattactttctttgtgctgaaactcctggtgctgcaaaggcttgggtatctacgttgcttgcaacacaattagtactacaagcgcataaagaagcagtgaattctttggctgggaacggctctcctgccacgttaggtacagttgctacagcagttgctaatgccaacgctactgctttggaggctaccaaggagatagaagcagcaatgaaagtttcaatgagggcagctcttgggttgggtgcaaacaatccaaaggaaggtcaacttgatgatttaaccatcatgaaggagactcttcgggtgaaagatgaggagttgcagaatttggccaaggatattcgtgctcgggatgctacaattaaggaaatagcaaataaattaacagagactgcagaggctgcggaagctgctgcttctgcagcccatacgatggatgaacagagaagacttctatgttcggagatcgagcgcctaagacaagcaatggaaagacaaatggaacaatccatgctcaagctaagacaatctgaagaaaaggtaattagcttgagtaaagagaaggaccaattgctgaaggaaagagatgctgcacttcaggaggctcatatgtggcgcactgagctagggaaagctagagagcaagcagtaatacaagaagcaactattgccagagcagatgagaaggtaagggcatctgaagcagatgctgcagctcggataaaggaagctgctgaaaagttacatgctgttgagaaagaaaaagaggagcttctatcccttgttggtattcttcaatcacaagtccagagagagcaaagcagcacgaagcaggtatgcgaagagagatctgaatcatgctccggcaccgataactcccctcccttgacaaagcacgtcgatgcatcagatgacgatgtcgacaaagcttgtgtgagtgactcaagatctgtcctagtttccaatgataacactgaagtccaactggccgtggatggggtcgacatccgtcctatcggtgatgcggagtggggtagtttccagcagtcggaagcattgatcgccgatgtgcgggaggtctccccagaatcagaaggcggcagcttggatatccctgtggtcaaccccccaccagtgagcgatcatatccagggaggcgcaacccacccctga</cdnaseq>

Protein Sequence

<aaseq>MATNGSSPRARETESSLEKVKRQLSSGSGRYLLQGPLLKRSETL RKWNERWVILDPTSGKMEYKIRRNETAIKGTIIFDASSTITLSPVNFQGMPKYDGCCF YIGTPQKKDYFLCAETPGAAKAWVSTLLATQLVLQAHKEAVNSLAGNGSPATLGTVAT AVANANATALEATKEIEAAMKVSMRAALGLGANNPKEGQLDDLTIMKETLRVKDEELQ NLAKDIRARDATIKEIANKLTETAEAAEAAASAAHTMDEQRRLLCSEIERLRQAMERQ MEQSMLKLRQSEEKVISLSKEKDQLLKERDAALQEAHMWRTELGKAREQAVIQEATIA RADEKVRASEADAAARIKEAAEKLHAVEKEKEELLSLVGILQSQVQREQSSTKQVCEE RSESCSGTDNSPPLTKHVDASDDDVDKACVSDSRSVLVSNDNTEVQLAVDGVDIRPIG DAEWGSFQQSEALIADVREVSPESEGGSLDIPVVNPPPVSDHIQGGATHP</aaseq>

Gene Sequence

<dnaseqindica>3280..3640#2860..3152#2556..2783#1699..1930#1395..1476#1285..1316#1121..1204#973..1034#229..333#115..138#ggtcgacgccaccccccaccggccggccccgtctcgccgtcgccgccgtcgtctccgccacccaaaaccctagccctgcagcctcccctccgcagctcgccccctctcctcgccatggccaccaacggcagctccccggtacgacgacgacccgggatgtttctgggactttttcccccgatttccggcgattcttatgagagtttttttttcttttttgggttgcagagggcgagggagactgagagcagcctggagaaggtgaagcggcagctctcgtcggggtccgggcggtacctgctgcaggggccactgctgaagcgatctgagacggtatggtctcgccggtcgtatttcgtgagcgggtgtgatgggattgtatggggggtgtttattaggcgaggtttttggtgataggtttgatctatgaggtttttctggtgttgaatggttcgatttgagtctgcccttgagaattcttgtgtgcgagtattagggattttgatgtgtggttggttggtggtaggagaaattatggttcgattatgtgtgtagctattctgttcgatttcttggaatgatttttgttgaagtgatagggagtatgtgagatttggtgagtaagagctaggagcatcgcattgacctttgtcggtggcatcgtccaagtaaccatgttgtggtatttgagtctagtgtgatagactagagagaaaggggaagccaggtgaatcttattccaagggtagaatgaactttattttgagataaacataagtcatagggcgcctgccgttgatacattggtgcacacgaatttgctactgaccaggaaaatacaatctagtgaatcgactaggaccaattctgttcaaacaaatgcaatcagtggaaactagcaaacatagtttgttctgaaatgtgaaaatcacggcagcaatctaacctcttcgatttttttccgtcgtacagttgaggaaatggaatgagagatgggtaattttagaccctacttcaggaaagatggaatacaagtatggagaactttgaaagttttgtgactaaataccaattaaattcctgctattttctctgtactcatttttttcccttgttgcagaattcggagaaatgaaactgccattaaaggaaccattatatttgatgcttcaagcactattaccttgtcccctgtaaatttccagtaagattatctactgtatataaacttttcttggtatggtatttcgaagtttgaactaactactgctcaaattcttacagagggatgccaaagtatgatggctgctgtttctgtatcctttacacttgctcaatgtttttttaaggagtgtatatgcttttagtttttagtgttccttgacttcagatagacattggaactcctcaaaaaaaggattactttctttgtgctgaaactcctggtgctgcaaaggcttgggtatctacgttgctgtaagctttctgatccatgacttgtcaaatattgtcatactcccagattgctgcccactgccagtcatttacaaatgctaattcctaaacattactgcaaacacacatactccaatatgaacgggcaaatgaatgcgatgtattttctctctctctgaaaaaggtgtaggcaggagaattgctaccactctatcttgggctgatattatctattttaaacagtgcaacacaattagtactacaagcgcataaagaagcagtgaattctttggctgggaacggctctcctgccacgttaggtacagttgctacagcagttgctaatgccaacgctactgctttggaggctaccaaggagatagaagcagcaatgaaagtttcaatgagggcagctcttgggttgggtgcaaacaatccaaaggaaggtcaacttgatgatttaaccatcatgaaggtatgcattcttttctcagcgaagatagattctctcatctaaaatcttgtttcatattgcaagtggtcttgctcttctagataatctttactttgctgctttcaaatattttctgtgataacatttctattttattagttttaaatcgtatggtgtcccatctctacctatgaagcagaccacactctagtattcgcacttggtactgatttcatacagggcattacgaactgcagacaatattcctacatgctttacatcgttgctgtcaacctgtgctagtgtaatattaggttggttgcctcaggctagattgccagattaatatattatgtataaacttggtgcaaatttatgccacagaacatacctggttaattataagtagatgagatttggcttttattgggagtctgaaaattgttgtaatattgtatgacataaatttacactgtttggtatgatttgttcaacaatgttttccatttctaaacattttagatggttacatctttgcttattaggtttcaattttcatgcatgtgctgctaggcacatggttgggtatctttgattttattcatgagcattattttgtcaattttctacttttcatattcctcaggagactcttcgggtgaaagatgaggagttgcagaatttggccaaggatattcgtgctcgggatgctacaattaaggaaatagcaaataaattaacagagactgcagaggctgcggaagctgctgcttctgcagcccatacgatggatgaacagagaagacttctatgttcggagatcgagcgcctaagacaagcaatggaaagacaaatggaacaatccatgctcaaggtaaatagttatatttaatatctgaatttcgaatgctctgaattctcatgctccaaatggtctatggatattacagctaagacaatctgaagaaaaggtaattagcttgagtaaagagaaggaccaattgctgaaggaaagagatgctgcacttcaggaggctcatatgtggcgcactgagctagggaaagctagagagcaagcagtaatacaagaagcaactattgccagagcagatgagaaggtaagggcatctgaagcagatgctgcagctcggataaaggaagctgctgaaaagttacatgctgttgagaaagaaaaagaggagcttctatcccttgttggtattcttcaatcacaagtccagaggtttgtcttgttttatgtgttctgcatttactgagttaaaagagaaatttatataagagatggaagcatctcacgagttatgcattacaacattgtcattgacctaaacacgaacctactgatgcagagagcaaagcagcacgaagcaggtatgcgaagagagatctgaatcatgctccggcaccgataactcccctcccttgacaaagcacgtcgatgcatcagatgacgatgtcgacaaagcttgtgtgagtgactcaagatctgtcctagtttccaatgataacactgaagtccaactggccgtggatggggtcgacatccgtcctatcggtgatgcggagtggggtagtttccagcagtcggaagcattgatcgccgatgtgcgggaggtctccccagaatcagaaggcggcagcttggatatccctgtggtcaaccccccaccagtgagcgatcatatccagggaggcgcaacccacccctgaaggcctggagccaaatacattctgggattgttgtgattattgaggataaccgactgggatttgaatcctttcgagaattgctgtggcaggagttcgcaccggtgcctggttgtatgttcattgtattaaaactatacgactcaaataaaagatagcggtggcttgtgtgtgtaaattgttcggttcaagctctcttttgttacattctgacttcaatgcattaaagtagtagtaactgttaaaacggcagattagcagtgtgaatgtgagatcttgtcaacttgg</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0666200, RefSeq:Os03g0666200