Difference between revisions of "Os12g0438600"

From RiceWiki
Jump to: navigation, search
(Evolution)
Line 25: Line 25:
  
 
== Evolution ==
 
== Evolution ==
[[File:08.jpg|300px|thumb|right|figure 8]]
+
[[File:08.jpg|300px|thumb|left|figure 8]]
 
The AtCLC proteins were predicted to consist of 9–11 transmembrane spanning domains and two conserved CBS domains at the carboxyl end. These domains were similar in sizes and positions to those of CLC-0 and mammalian CLCs.<ref name="ref2" />.
 
The AtCLC proteins were predicted to consist of 9–11 transmembrane spanning domains and two conserved CBS domains at the carboxyl end. These domains were similar in sizes and positions to those of CLC-0 and mammalian CLCs.<ref name="ref2" />.
 
Phylogeny of predicted AtCLC proteins shown in fiugre.
 
Phylogeny of predicted AtCLC proteins shown in fiugre.

Revision as of 08:20, 7 June 2014

Annotated Information

Function

Representation of the AtCLCaNO32Ht antiporter in a plant cell.
Vacuolar chloride is transported differently by native AtCLCaWT andthe mutant AtCLCaP160S.
Homology model of the AtCLCa C-terminal region. a, the alignment used for the homology modeling of AtCLCa C-terminal region on the hCLC-5 C-terminal region. b, detail of the region putatively involved in the ATP-AtCLCa interaction.

AtCLC-a, a member of the CLC family of anion transporters, is involved mainly in nitrate storage in the vacuole. CLCa (AtCLCa) is localized to an intracellular membrane, the tonoplast of the plant vacuole, with anion transport ability. AtCLCa is able to accumulate specifically nitrate in the vacuole and behaves as a NO32-/H+ exchanger.

In Monachello's study, analyses of T-DNA insertion mutants within the AtClCa and AtClCe genes revealed common phenotypic traits: a lower endogenous nitrate content; a higher nitrite content; a reduced nitrate influx into the root; and a decreased expression of several genes encoding nitrate transporters. This set of nitrate-related phenotypes, displayed by clca and clce mutant plants, showed interconnecting roles of AtClCa and AtClCe in nitrate homeostasis involving two different endocellular membranes [1].

Electrophysiological studies show that, at physiological membrane potentials, AtCLCa-mediated current is able to transport NO3 2- into the vacuole (negative current), when cytosolic [NO3 2-] is in a physiological range. Nevertheless, there is a clear discrepancy between the measured Erev and the Nernst potential for NO3 2. This observation demonstrates that other ions are transported by AtCLCa [2]. The high selectivity of AtCLCa for nitrate ions compared with chloride ions seems to be a peculiarity of this plant CLC and is in agreement with the clca knockout mutant phenotype.

By monitoring AtCLCa activity in its native environment, Stefanie Wege found that if proline 160 in AtCLCa is changed to a serine (AtCLCaP160S), the transporter loses its nitrate selectivity, but the anion proton exchange mechanism is unaffected. The results confirm the significance of this amino acid in the conserved selectivity filter of CLC proteins and highlight the importance of nitrate metabolism in Arabidopsis[3].

ATP reversibly inhibits AtCLCa by interacting with the C-terminal domain. Applying the patch clamp technique to isolated Arabidopsis thaliana vacuoles, Alexis De Angeli demonstrate that ATP reduces AtCLCa activity with a maximum inhibition of 60%. ATP inhibition of nitrate influx into the vacuole at cytosolic physiological nitrate concentrations suggests that ATP modulation is physiologically relevant. ADP and AMP do not decrease the AtCLCa transport activity; nonetheless, AMP (but not ADP) competes with ATP, preventing inhibition[4].


Expression

The rice genome has been completely sequenced and comprises five CLC homologues, but only two members from Oryza sativa L., OsClC-1 and OsClC-2 have been characterized . The highest homology with the plant subgroup comprising AtClC-a to –g, OsClC-1 is expressed in most tissues, whereas OsClC-2 is expressed only in roots, nodes, internodes and leaf sheaths, but for both of them vacuolar localization has been suggested [5].

To determine the subcellular localization of the AtCLCa protein, green fluorescent protein (GFP) fusion proteins were transiently expressed in protoplasts from Arabidopsis cell suspensions. Confocal microscopy studies revealed a green fluorescent labelling that coincided with the tonoplast[2].

Evolution

figure 8

The AtCLC proteins were predicted to consist of 9–11 transmembrane spanning domains and two conserved CBS domains at the carboxyl end. These domains were similar in sizes and positions to those of CLC-0 and mammalian CLCs.[6]. Phylogeny of predicted AtCLC proteins shown in fiugre.

Labs working on this gene

  • Institute for Plant Biology, University of Zurich, CH-8008 Zurich, Switzerland. Alexis De Angeli
  • Institut des Sciences du Végétal, Centre National de la Recherche Scientifique, France. Geneviève Ephritikhine
  • School of Life Science and Technology, Tongji University, Shanghai, China. Zhixue Liu
  • National Key Laboratory of Plant Molecular Genetics, Shanghai Institute of Plant Physiology and Ecology, Chinese Academy of Sciences, Shanghai, China. Hong-xia Zhang
  • Universite Paris 7-Denis Diderot, UFR Biologie Sciences de la Nature, France. G. Ephritikhine

References

  1. Monachello D, Allot M, Oliva S, Krapp A, Daniel-Vedele F, Barbier-Brygoo H and Ephritikhine G (2009) Two anion transporters AtClCa and AtClCe fulfil interconnecting but not redundant roles in nitrate assimilation pathways. The New phytologist 183:88-94.
  2. 2.0 2.1 De Angeli A, Monachello D, Ephritikhine G, Frachisse JM, Thomine S, Gambale F and Barbier-Brygoo H (2006) The nitrate/proton antiporter AtCLCa mediates nitrate accumulation in plant vacuoles. Nature 442:939-942.
  3. Wege S, Jossier M, Filleur S, Thomine S, Barbier-Brygoo H, Gambale F and De Angeli A (2010) The proline 160 in the selectivity filter of the Arabidopsis NO(3)(-)/H(+) exchanger AtCLCa is essential for nitrate accumulation in planta. The Plant journal : for cell and molecular biology 63:861-869.
  4. De Angeli A, Moran O, Wege S, Filleur S, Ephritikhine G, Thomine S, Barbier-Brygoo H and Gambale F (2009) ATP binding to the C terminus of the Arabidopsis thaliana nitrate/proton antiporter, AtCLCa, regulates nitrate transport into plant vacuoles. The Journal of biological chemistry 284:26526-26532.
  5. Zifarelli G and Pusch M (2010) CLC transport proteins in plants. FEBS letters 584:2122-2127.
  6. Lv Q-d, Tang R-j, Liu H, Gao X-s, Li Y-z, Zheng H-q and Zhang H-x (2009) Cloning and molecular analyses of the Arabidopsis thaliana chloride channel gene family. Plant Science 176:650-661.

Structured Information

Gene Name

Os12g0438600

Description

Similar to Chloride channel protein CLC-a (AtCLC-a)

Version

NM_001073224.1 GI:115488409 GeneID:4352132

Length

3607 bp

Definition

Oryza sativa Japonica Group Os12g0438600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 12

Location

Chromosome 12:14635483..14639089

Sequence Coding Region

14635749..14635847,14636418..14638079,14638194..14638371,14638457..14638641

Expression

GEO Profiles:Os12g0438600

Genome Context

<gbrowseImage1> name=NC_008405:14635483..14639089 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008405:14635483..14639089 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>tctgttcaagcacgactggaggaggcgatcgaacgtggaggtgctgcagtacatcttcctcaagtgggccatggcgttcctcgtcggcctcctcaccggcgtcatcgcgtcgctcatcaacctcgccatcgagaacatctccggcctcaagatgctccacatggtgcagctcgtccgcaagaaaaatactgggccggtttcttgtatttcgccggcgtcaacttcggcctgacgttcatcgccgccatgctctgcgtcgtcttcgccccgaccgccgccggccccggcatcccggagatcaaggcctacctcaacggcgtcgacacgcccaacatgttcggcgcgccgcagctcattgtcaagatcatcggtagcatctgcgcggtgtcgtcggggctggatctcgggaaggaagggccactggtgcacatcggcgcgtgcctggcgaacttgctgagccagggcggctccggccggcaccgcctccggttgcggtggctgcgctacttcgacaacgaccgcgaccggcgcgacctgatcacctgcggcgcgtcgtcgggcgtgtgcgcggcgttccgggcgcccgtcggcggcgtgctgttcgcgctggaggaggtggcgacgtggtggcggagcgcgctgctgtggcgcaccttcttcagcacggccaccgtcgtcgtcgtcctccgcgggttcatcgaggtgtgcaggaacgggcggtgcggtctgttcggcgagggcgggctcatcctgttcgacgtcggcgacgtcgccgtccggtaccacgccggcgacctcctcccggtgaccatcgtcggcgtgcttggcggcgtcctcggcgcgctgtacaaccacgtcctccacaaggtgctccgcgtgtacaacctcatcaacgagaagggccgcgccgcgaagctcgccctggcgctcgccgtgtgcgcgctcacgtcggcgctgctgtacgtgacgccgttcgccgtgccgtgcacgccgtgcgacccggcgttcggcggcgcgtgcccgacgctggggaagagcggcaacttcaagcggttcaactgccccgagggccactacaacgacctcgccaccctcctccacgccaccaacgtcgacgcgacgcggaacatcttctccacgggcaccgccggcgagttcaggctcgactcgctgctcatcttcttcgccgtctactgcgtcctgggcctcttcaccttcggcatcgccgtcccctcggggctcttcctccccatcatcctcatgggctccgcctacggccgcgtcacggcgctcgtgctgtcgcggttcgcccgcatcgaccacggcctatacgccgtgctcggcgcggcggcgctcatgtcggggtccatgcggatgaccgtgtcgctcgtcgtcatcttcctcgagctcaccaacaacctcctcctcctcccaatcaccatgttcgtcctcctcatcgccaagaccgtcggcgacgcgttcaaccccagcatctacgagatcatcctcgacctcaagggcctcccgttcctggaggcgaagccggagccgtggatgaaggacctcaccgtcggcgagctcgccgccgccaagccccgcgccgtggcgctccaggtggtggagcgcgtgtccacggtggtggaggcgctccgggcgacgcggcacaacgggttcccggtgctggaccggccgcggcccggggtatcggagctgcacgggctggtgctccggtcgcacctcgtcgccgcgctgaggaagcggtggttcctgccggagaggaggaggacggaggagtgggaggcccgcgagatgttcagctcggcggagctcgcggacaagtgcggcggcgtggacgagctggagatctcgccggaggagatggggatgtacgtggacctccacccgctgacgaacacgacgccgtacaccgtggtggagaccatgtcggtggcgaaggccgtcgtgctgttccgctccgtcgcgctccgccacatgctcatcatgcccaagttccaaggacccgagatatctccaattgtggggatcttgacaaggcaggacctgatagcacacaacatcctcggtgcatttccacaccttgcaagcaagaggaaaacacattga</cdnaseq>

Protein Sequence

<aaseq>SVQARLEEAIERGGAAVHLPQVGHGVPRRPPHRRHRVAHQPRHR EHLRPQDAPHGAARPQEKYWAGFLYFAGVNFGLTFIAAMLCVVFAPTAAGPGIPEIKA YLNGVDTPNMFGAPQLIVKIIGSICAVSSGLDLGKEGPLVHIGACLANLLSQGGSGRH RLRLRWLRYFDNDRDRRDLITCGASSGVCAAFRAPVGGVLFALEEVATWWRSALLWRT FFSTATVVVVLRGFIEVCRNGRCGLFGEGGLILFDVGDVAVRYHAGDLLPVTIVGVLG GVLGALYNHVLHKVLRVYNLINEKGRAAKLALALAVCALTSALLYVTPFAVPCTPCDP AFGGACPTLGKSGNFKRFNCPEGHYNDLATLLHATNVDATRNIFSTGTAGEFRLDSLL IFFAVYCVLGLFTFGIAVPSGLFLPIILMGSAYGRVTALVLSRFARIDHGLYAVLGAA ALMSGSMRMTVSLVVIFLELTNNLLLLPITMFVLLIAKTVGDAFNPSIYEIILDLKGL PFLEAKPEPWMKDLTVGELAAAKPRAVALQVVERVSTVVEALRATRHNGFPVLDRPRP GVSELHGLVLRSHLVAALRKRWFLPERRRTEEWEAREMFSSAELADKCGGVDELEISP EEMGMYVDLHPLTNTTPYTVVETMSVAKAVVLFRSVALRHMLIMPKFQGPEISPIVGI LTRQDLIAHNILGAFPHLASKRKTH</aaseq>

Gene Sequence

<dnaseqindica>3243..3341#1011..2672#719..896#449..633#acacatacacacacatatctcatcttgttgtttctgagctgctccaagaagcagagctctgtccatggaggaggagcagagcccgaggctcgccgccggcgagccggagcgcaagctcgaggacggagtcaccgacgccgaggaccccgggtgcacgggcaatgcggccatgagctcgctggagcagccgcttctgaagcggagcaacacgctaacggccagccacctcgccatggttggcgccaaggtctcccacatcgagagcctcgactacgagtgagcattttctcctcctcctcctccatgtctaattcaccgtgctcgatcacgagtccatcaattcttggattcttgatttgttgattctcgatcggttggtttaattaatctgttcttgcattttttttcaatttgtgatgtgtgaatttggtagaattatcgagaatgatctgttcaagcacgactggaggaggcgatcgaacgtggaggtgctgcagtacatcttcctcaagtgggccatggcgttcctcgtcggcctcctcaccggcgtcatcgcgtcgctcatcaacctcgccatcgagaacatctccggcctcaagatgctccacatggtgcagctcgtccgcaagaaaagttaagcccacaactcctccttcttcttcctcatcgccggcgacgagttcttgatggtgaaaaatttgccgtcaccctactgcagatactgggccggtttcttgtatttcgccggcgtcaacttcggcctgacgttcatcgccgccatgctctgcgtcgtcttcgccccgaccgccgccggccccggcatcccggagatcaaggcctacctcaacggcgtcgacacgcccaacatgttcggcgcgccgcagctcattgtcaaggtcacaaaaaaaaaatgtcacacttctccaacgtgtcggaacaacatttttttttcgattaaacggcagacgcgcacacactgacgagtagaaaaaaatgtatgatcatcgcagatcatcggtagcatctgcgcggtgtcgtcggggctggatctcgggaaggaagggccactggtgcacatcggcgcgtgcctggcgaacttgctgagccagggcggctccggccggcaccgcctccggttgcggtggctgcgctacttcgacaacgaccgcgaccggcgcgacctgatcacctgcggcgcgtcgtcgggcgtgtgcgcggcgttccgggcgcccgtcggcggcgtgctgttcgcgctggaggaggtggcgacgtggtggcggagcgcgctgctgtggcgcaccttcttcagcacggccaccgtcgtcgtcgtcctccgcgggttcatcgaggtgtgcaggaacgggcggtgcggtctgttcggcgagggcgggctcatcctgttcgacgtcggcgacgtcgccgtccggtaccacgccggcgacctcctcccggtgaccatcgtcggcgtgcttggcggcgtcctcggcgcgctgtacaaccacgtcctccacaaggtgctccgcgtgtacaacctcatcaacgagaagggccgcgccgcgaagctcgccctggcgctcgccgtgtgcgcgctcacgtcggcgctgctgtacgtgacgccgttcgccgtgccgtgcacgccgtgcgacccggcgttcggcggcgcgtgcccgacgctggggaagagcggcaacttcaagcggttcaactgccccgagggccactacaacgacctcgccaccctcctccacgccaccaacgtcgacgcgacgcggaacatcttctccacgggcaccgccggcgagttcaggctcgactcgctgctcatcttcttcgccgtctactgcgtcctgggcctcttcaccttcggcatcgccgtcccctcggggctcttcctccccatcatcctcatgggctccgcctacggccgcgtcacggcgctcgtgctgtcgcggttcgcccgcatcgaccacggcctatacgccgtgctcggcgcggcggcgctcatgtcggggtccatgcggatgaccgtgtcgctcgtcgtcatcttcctcgagctcaccaacaacctcctcctcctcccaatcaccatgttcgtcctcctcatcgccaagaccgtcggcgacgcgttcaaccccagcatctacgagatcatcctcgacctcaagggcctcccgttcctggaggcgaagccggagccgtggatgaaggacctcaccgtcggcgagctcgccgccgccaagccccgcgccgtggcgctccaggtggtggagcgcgtgtccacggtggtggaggcgctccgggcgacgcggcacaacgggttcccggtgctggaccggccgcggcccggggtatcggagctgcacgggctggtgctccggtcgcacctcgtcgccgcgctgaggaagcggtggttcctgccggagaggaggaggacggaggagtgggaggcccgcgagatgttcagctcggcggagctcgcggacaagtgcggcggcgtggacgagctggagatctcgccggaggagatggggatgtacgtggacctccacccgctgacgaacacgacgccgtacaccgtggtggagaccatgtcggtggcgaaggccgtcgtgctgttccgctccgtcgcgctccgccacatgctcatcatgcccaagttccaaggacccgaggtcagcgccaaaacacagactgaattttactccctggttacaagacgatccaagtcaaactgttttaagtttgattaaagtttatagaaaaaataataataacattttcaaccaagacaaatttattataaatatatattcaattattggtttgatgaaacttatttagtattataaatattatcatatttgtctatgaatttagtcaaacttgaaacagtttaactttgattaaagtcaaagcgttttataacctgaaacggagtaagtatttgtttattaatttacttattattttccaactacattcctggatcacaatgcaagtaaatgttgttctaagatcacaataatctctggattctgtatgtgcttgataaatcagatatgtgcagaatctgtgttctgtcctggtcttttgttacagaactggggatttagtgtcttatcagtgtcttatcatttctagaattttgctttgctttgtagaatacgggttagtgatcatttgttgaactcaatttgtgcatagttcggtgatgaaacttatgtttttttttttaatttcagatatctccaattgtggggatcttgacaaggcaggacctgatagcacacaacatcctcggtgcatttccacaccttgcaagcaagaggaaaacacattgagaggaaccatttttgagagttaatccatctttattgtcttgaagccaaatatcagagtcacctgcatatacagcttttatgaggctttgagttttttttcttttttttttcagttatcctcttctctgtaagtagattcaggattattatttgctgctcttctgagagtgcttgaataattgctgccaatgtaaaatcacacatgtaactatgccagatgtaatcaaaagggacacaaccatgatgcaatagagcaattctttttt</dnaseqindica>

External Link(s)

NCBI Gene:Os12g0438600, RefSeq:Os12g0438600