Difference between revisions of "Os04g0572400"
(→Evolution) |
(→Function) |
||
| Line 3: | Line 3: | ||
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| − | Most dehydration-responsive element-binding (DREB) factors interact specifically with the dehydration-responsive element (DRE) and control the expression of many stress-inducible genes in Arabidopsis. OsDREB are homologous to Arabidopsis DREB genes. Over-expression of OsDREB genes lead to enhanced drought tolerance in rice. Transgenic rice plants analysis revealed that over-expression of OsDREB1G and OsDREB2B in rice significantly improved their tolerance to water deficit stress, while over-expression of OsDREB1E could only slightly improved the tolerance to water deficit stress, suggesting that the OsDREBs might participate in the stress response pathway in different manners (Chen et al. 2008). | + | Most dehydration-responsive element-binding (DREB) factors interact specifically with the dehydration-responsive element (DRE) and control the expression of many stress-inducible genes in Arabidopsis. OsDREB are homologous to Arabidopsis DREB genes. Over-expression of OsDREB genes lead to enhanced drought tolerance in rice. Transgenic rice plants analysis revealed that over-expression of OsDREB1G and OsDREB2B in rice significantly improved their tolerance to water deficit stress, while over-expression of OsDREB1E could only slightly improved the tolerance to water deficit stress, suggesting that the OsDREBs might participate in the stress response pathway in different manners (Chen et al. 2008).(fig.1) |
| + | [[File: Chen-Os04g0572400-Fig1.jpg|right|thumb|200px|''Fig. 1 Alignment of deduced amino acid sequences of DREB1s. OsDREB1E, OsDREB1G have high similarity in conserved AP2 domain, N-terminal NLS, C-terminal LWSY motif with reported DREB1s. Asterisks indicate the wellconserved | ||
| + | valine and glutamic acid in the DREB1 proteins. (from reference <ref name="Chen" />).'']] | ||
| − | OsDREB4 Genes in Rice Encode AP2-Containing Proteins that Bind Specifically to the Dehydration-Responsive Element. OsDREB4-1 and OsDREB4-2 proteins specifically bound to DRE and activated expression of the dual reporter genes of histidine (HIS3) and galactosidase (LacZ). OsDREB4-1 could function as a trans -acting factor in the DRE/DREB regulated stress-responsive pathway. The expression of the OsDREB genes could be controlled by specific aspects of differentiation or development (Tian et al. 2005). | + | OsDREB4 Genes in Rice Encode AP2-Containing Proteins that Bind Specifically to the Dehydration-Responsive Element. OsDREB4-1 and OsDREB4-2 proteins specifically bound to DRE and activated expression of the dual reporter genes of histidine (HIS3) and galactosidase (LacZ). OsDREB4-1 could function as a trans -acting factor in the DRE/DREB regulated stress-responsive pathway. The expression of the OsDREB genes could be controlled by specific aspects of differentiation or development (Tian et al. 2005).(fig.2) |
| + | [[File: Chen-Os04g0572400-Fig2.jpg|right|thumb|200px|''Fig. 2 Alignment of the deduced amino acid sequences of dehydration-responsive element-binding (DREB1)-related proteins. Amino acid residues in white on a black background are those identical in more than three sequences. The | ||
| + | broken overline indicates nuclear localization signals (NLS). The single overline indicates AP2 domains and asterisks indicate the well-conserved valine and glutamic acid among the DREB-related proteins. DREB1A−C, Arabidopsis (Liu et al. 1998); OsDREB1A−D, rice (Dubouzet et al. 2003).. (from reference <ref name="Tian" />).'']] | ||
===Expression=== | ===Expression=== | ||
Revision as of 13:41, 9 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
Function
Most dehydration-responsive element-binding (DREB) factors interact specifically with the dehydration-responsive element (DRE) and control the expression of many stress-inducible genes in Arabidopsis. OsDREB are homologous to Arabidopsis DREB genes. Over-expression of OsDREB genes lead to enhanced drought tolerance in rice. Transgenic rice plants analysis revealed that over-expression of OsDREB1G and OsDREB2B in rice significantly improved their tolerance to water deficit stress, while over-expression of OsDREB1E could only slightly improved the tolerance to water deficit stress, suggesting that the OsDREBs might participate in the stress response pathway in different manners (Chen et al. 2008).(fig.1)
OsDREB4 Genes in Rice Encode AP2-Containing Proteins that Bind Specifically to the Dehydration-Responsive Element. OsDREB4-1 and OsDREB4-2 proteins specifically bound to DRE and activated expression of the dual reporter genes of histidine (HIS3) and galactosidase (LacZ). OsDREB4-1 could function as a trans -acting factor in the DRE/DREB regulated stress-responsive pathway. The expression of the OsDREB genes could be controlled by specific aspects of differentiation or development (Tian et al. 2005).(fig.2)
Expression
In rice, OsDREB1A and OsDREB2A can specifically bind to the DRE element, and the OsDREB1A preferentially binds to GCCGAC than to ACCGAC whereas the AtDREB1A protein binds more efficiently to both GCCGAC and ACCGAC (Chen et al. 2003). The DNA-binding specificity of OsDREB4 had also been studied and the results indicated that OsDREB4 could specifically bind to DRE element (Tian et al. 2005).
In rice seedlings, expression of OsDREB4-1 was induced by dehydration and high salt, whereas OsDREB1-1 and OsDREB4-2 were expressed constitutively. Under normal growth conditions, OsDREB1-1 was expressed strongly in the leaf, sheath, and spike, was expressed relatively weak in the stem and only faintly expressed in the roots, whereas expression of transcripts of OsDREB4-1 and OsDREB4-2 was higher in the roots, stem, and spike, lower in the leaf, and undetectable in the sheath (Tian et al. 2005). .
Evolution
Phylogenic analysis of all DREB proteins reported revealed that a close relationship existed between OsDREB1E, OsDREB1G, or OsDREB2B and reported DREB proteins (Fig.3).
You can also add sub-section(s) at will.
Labs working on this gene
1. Department of Plant Science, College of Biological Sciences, China Agricultural University, Beijing 100094, China;
2. Plant Biotechnology Laboratory, Institute of Genetics and Developmental Biology, the Chinese Academy of Sciences, Beijing 100101, China
3. College of Life Sciences, Beijing Normal University, Beijing 100875, China
4. chool of Life Sciences, Fudan University, Shanghai 200433, China
5. National Center for Molecular Crop Design, Weiming Kaituo Agriculture Biotech Co., Ltd, Beijing 100085 ,China
References
1. Chen J Q, Meng X P, Zhang Y, et al. Over-expression of OsDREB genes lead to enhanced drought tolerance in rice[J]. Biotechnology letters, 2008, 30(12): 2191-2198.
2. Tian X H, Li X P, Zhou H L, et al. OsDREB4 Genes in Rice Encode AP2‐Containing Proteins that Bind Specifically to the Dehydration‐Responsive Element[J]. Journal of Integrative Plant Biology, 2005, 47(4): 467-476.
Structured Information
| Gene Name |
Os04g0572400 |
|---|---|
| Description |
Similar to CRT/DRE binding factor 1 |
| Version |
NM_001060143.1 GI:115460015 GeneID:4336721 |
| Length |
660 bp |
| Definition |
Oryza sativa Japonica Group Os04g0572400, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 4:29219354..29220013 |
| Sequence Coding Region |
29219354..29220013 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008397:29219354..29220013 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008397:29219354..29220013 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagtgggcgtactacggcagtgggtactcctcgtcggggacgccgtcgccggtgggcggcgacggggacgaggactcgtacatgacggtgtcgtcggcgccgcccaagcggcgggcggggaggaccaagttcaaggagacgaggcacccggtgtacaagggcgtgcgcagcaggaaccccgggaggtgggtctgcgaggtgcgcgagccgcacggcaagcagaggatctggctcggcaccttcgagaccgccgagatggcggcgcgcgcgcacgacgtcgcggcgatggcgctgcgcggccgcgccgcctgcctcaacttcgccgactcgccgcgcaggctccgcgtgccgccgctgggggccgggcacgaggagatacgccgcgccgcggtcgaggccgccgagctgttccgcccggcgcccgggcagcacaatgcggctgccgaggcggcggccgctgtcgctgcgcaggcaaccgcggcgagcgcggagctctttgccgacttcccttgctacccgatggacggactggaattcgaaatgcaggggtacctcgacatggcacagggaatgctcatcgagccgccgccattggcagggcaatcgacgtgggccgaggaggactacgactgcgaggtcaatctatggagctactga</cdnaseq> |
| Protein Sequence |
<aaseq>MEWAYYGSGYSSSGTPSPVGGDGDEDSYMTVSSAPPKRRAGRTK FKETRHPVYKGVRSRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAAMALRGR AACLNFADSPRRLRVPPLGAGHEEIRRAAVEAAELFRPAPGQHNAAAEAAAAVAAQAT AASAELFADFPCYPMDGLEFEMQGYLDMAQGMLIEPPPLAGQSTWAEEDYDCEVNLWS Y</aaseq> |
| Gene Sequence |
<dnaseqindica>1..660#atggagtgggcgtactacggcagtgggtactcctcgtcggggacgccgtcgccggtgggcggcgacggggacgaggactcgtacatgacggtgtcgtcggcgccgcccaagcggcgggcggggaggaccaagttcaaggagacgaggcacccggtgtacaagggcgtgcgcagcaggaaccccgggaggtgggtctgcgaggtgcgcgagccgcacggcaagcagaggatctggctcggcaccttcgagaccgccgagatggcggcgcgcgcgcacgacgtcgcggcgatggcgctgcgcggccgcgccgcctgcctcaacttcgccgactcgccgcgcaggctccgcgtgccgccgctgggggccgggcacgaggagatacgccgcgccgcggtcgaggccgccgagctgttccgcccggcgcccgggcagcacaatgcggctgccgaggcggcggccgctgtcgctgcgcaggcaaccgcggcgagcgcggagctctttgccgacttcccttgctacccgatggacggactggaattcgaaatgcaggggtacctcgacatggcacagggaatgctcatcgagccgccgccattggcagggcaatcgacgtgggccgaggaggactacgactgcgaggtcaatctatggagctactga</dnaseqindica> |
| External Link(s) |