Difference between revisions of "Os07g0568700"

From RiceWiki
Jump to: navigation, search
(References)
(References)
Line 17: Line 17:
  
 
==References==
 
==References==
1. Seonghoe Jang;Byongho Lee;Chanhong Kim;Soo-Jin Kim;Jieun Yim;Jong-Jin Han;Shinyoung Lee;Seong-Ryong Kim;Gynheung An
+
1. Seonghoe Jang;Byongho Lee;Chanhong Kim;Soo-Jin Kim;Jieun Yim;Jong-Jin Han;Shinyoung Lee;Seong-Ryong Kim;Gynheung An;The OsFOR1 gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice
  The OsFOR1 gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice
 
 
   Plant Molecular Biology, 2003, 53(3): 357-372
 
   Plant Molecular Biology, 2003, 53(3): 357-372
  

Revision as of 13:13, 7 June 2014

The OsFOR1(Oryza sativa floral organ regulator 1) gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice.

Annotated Information

Function

OsFOR1 plays a role in the formation and/or maintenance of floral organ primordia.the OsFOR1 recombinant protein, when fused to maltose-binding protein (MBP), shows PGIP activity against the Aspergillus niger polygalacturonase. Antisense expression of OsFOR1 resulted in an increase in the numbers of floral organs, including the stamen, carpel, palea/lemma, stigma, and lodicule.

Expression

The OsFOR1 (Oryza sativa floral organ regulator 1) gene encodes a protein that contains a leucine-rich repeat (LRR) domain. This domain comprises 10 tandem repeats of a canonical 24-amino acid LRR sequence. The structure and the number of LRRs for OsFOR1 are similar to those of polygalacturonase-inhibiting proteins (PGIPs) from various other plant species.OsFOR1 is highly expressed in the calli and immature and mature panicles, while detectable at only low levels in seedling roots and mature stems. In situ hybridization experiments showed the transcripts of OsFOR1 are present in young spikelet primordia and in almost all of the young floral organs.

Evolution

Please input evolution information here.

Schematic representation of OsFOR1.

Labs working on this gene

Please input related labs here.

References

1. Seonghoe Jang;Byongho Lee;Chanhong Kim;Soo-Jin Kim;Jieun Yim;Jong-Jin Han;Shinyoung Lee;Seong-Ryong Kim;Gynheung An;The OsFOR1 gene encodes a polygalacturonase-inhibiting protein (PGIP) that regulates floral organ number in rice

 Plant Molecular Biology, 2003, 53(3): 357-372

Structured Information

Gene Name

Os07g0568700

Description

Polygalacturonase inhibitor 1 precursor (Polygalacturonase-inhibiting protein) (Floral organ regulator 1)

Version

NM_001066567.1 GI:115472866 GeneID:4343645

Length

1449 bp

Definition

Oryza sativa Japonica Group Os07g0568700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:23534415..23535863

Sequence Coding Region

23534806..23535804

Expression

GEO Profiles:Os07g0568700

Genome Context

<gbrowseImage1> name=NC_008400:23534415..23535863 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:23534415..23535863 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgtccaccgcctctttcatgctcgccgtcttgctggcggtggccgtcgcggcggcgccggcgagggcggtgcgatgcccgccgagcgacaagcaggcgctgatgagagtgaagcagtcgctgggaaacccggcgacgctgtcgacgtggtccctggcgtcggcggactgctgcgagtgggaccacgtccggtgcgacgaggccgggcgcgtgaacaacgtcttcatcgacggcgccaacgacgtccgcggccagatcccgtccgccgtggcggggctgacggcgctcatgtcgctgtcgctgttccgcctcccgggcctctccggccccatcccggcgtgcctcaccgcgctctccaacctccagttcctcaccatctcccacaccaacgtctccggcgtcatcccggactcgctcgcgcggatccgcagcctcgactccgtcgacctctcccacaacagcctgaccggccccatcccgaactccttctccgacctcccgaacctccggtcgcttgacctccgcagcaacaagctgacgggttgcatcccggcggggctcgtgcaggggcagttcaggtcgctgatcctctcctacaaccagctcaccggcccgatcccgcgcgacgacgcgcaggacgagatcaacaccgtcgacctctcgcacaaccgcctcaccggcgacgcctccttcctcttcgccgccggccggcccatcggcaaggtggacctctcgtggaacgacctcgacttcgacctcagcaagctcgtcttcccgccggagctcacctacctggacctcagccacaaccgcatcaggggcaccgtgccacgctccctcgccgcgctctccacgctgcagacgctggacctcagctacaaccgcctctgcggcccgctcccgaggctgcacggcgtcatccgccacggctgcaagccgtacgagcacaaccagtgcgccggcggcgccccgctcggcgggtgccaccaatcgtga</cdnaseq>

Protein Sequence

<aaseq>MASTASFMLAVLLAVAVAAAPARAVRCPPSDKQALMRVKQSLGN PATLSTWSLASADCCEWDHVRCDEAGRVNNVFIDGANDVRGQIPSAVAGLTALMSLSL FRLPGLSGPIPACLTALSNLQFLTISHTNVSGVIPDSLARIRSLDSVDLSHNSLTGPI PNSFSDLPNLRSLDLRSNKLTGCIPAGLVQGQFRSLILSYNQLTGPIPRDDAQDEINT VDLSHNRLTGDASFLFAAGRPIGKVDLSWNDLDFDLSKLVFPPELTYLDLSHNRIRGT VPRSLAALSTLQTLDLSYNRLCGPLPRLHGVIRHGCKPYEHNQCAGGAPLGGCHQS</aaseq>

Gene Sequence

<dnaseqindica>60..1058#actcactcacacacactcaagccagctccagccacacgagcctagttcaggtagatacaatggcgtccaccgcctctttcatgctcgccgtcttgctggcggtggccgtcgcggcggcgccggcgagggcggtgcgatgcccgccgagcgacaagcaggcgctgatgagagtgaagcagtcgctgggaaacccggcgacgctgtcgacgtggtccctggcgtcggcggactgctgcgagtgggaccacgtccggtgcgacgaggccgggcgcgtgaacaacgtcttcatcgacggcgccaacgacgtccgcggccagatcccgtccgccgtggcggggctgacggcgctcatgtcgctgtcgctgttccgcctcccgggcctctccggccccatcccggcgtgcctcaccgcgctctccaacctccagttcctcaccatctcccacaccaacgtctccggcgtcatcccggactcgctcgcgcggatccgcagcctcgactccgtcgacctctcccacaacagcctgaccggccccatcccgaactccttctccgacctcccgaacctccggtcgcttgacctccgcagcaacaagctgacgggttgcatcccggcggggctcgtgcaggggcagttcaggtcgctgatcctctcctacaaccagctcaccggcccgatcccgcgcgacgacgcgcaggacgagatcaacaccgtcgacctctcgcacaaccgcctcaccggcgacgcctccttcctcttcgccgccggccggcccatcggcaaggtggacctctcgtggaacgacctcgacttcgacctcagcaagctcgtcttcccgccggagctcacctacctggacctcagccacaaccgcatcaggggcaccgtgccacgctccctcgccgcgctctccacgctgcagacgctggacctcagctacaaccgcctctgcggcccgctcccgaggctgcacggcgtcatccgccacggctgcaagccgtacgagcacaaccagtgcgccggcggcgccccgctcggcgggtgccaccaatcgtgagcatccatccatccatcaccgccggcgagctgatgctgccacgtaaggtggagcccggggtgcgtaacggtatacgtgtttggtgttttttcgcgtacggggacgtggccgtgtagtacacggtacgacgggtgcagccgtgcagggtactgggcgggtttacgttagtacaaattgtaaccaaggtagagtgcctgcacgcgtgcgtggtcgactctccttcagattgtacgaaacgagggagccgtgtgtacgtgtgcgtacgtgtaccgtgtatggagtacgatgatgatgatgatgcaagtgtgtgtattgtgaatgtacgttatggatcgccctaatgtatcatcgaaatgataagtgtttgatataatttgcctttcgttcttgt</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0568700, RefSeq:Os07g0568700