Difference between revisions of "Os06g0499500"

From RiceWiki
Jump to: navigation, search
(References)
(=Function)
Line 12: Line 12:
  
 
You can also add sub-section(s) at will.
 
You can also add sub-section(s) at will.
 +
We classify rice GH3 proteins in two groups (groups I and II) on the basis of their phylogenetic relationship with Arabidopsis GH3 proteins. Based upon the sequences available in the database, we can not identify a single group III GH3 protein in rice. An extensive survey of EST sequences of other monocots led to the conclusion that although GH3 gene family is highly conserved in both dicots and monocots but the group III is conspicuous by its absence in monocots.
  
 
==Labs working on this gene==
 
==Labs working on this gene==

Revision as of 01:41, 8 June 2014

Please input one-sentence summary here.

Annotated Information

=Function

The GH3 is a class of genes that respond to Auxin in some species of plants. The GH3 proteins in Arabidopsis have been shown to be involved in plant growth and development, photomorphogenesis, light- and auxin-signaling, and auxin homeostasis. GH3 proteins from Arabidopsis and rice are divided into three and two groups, respectively. GH3 proteins classified in the same groups may have the similar functions in events common to both monocot and dicot plants. Group III GH3 proteins may have dicot-specific functions as they could not be identified from rice or other monocots. Organ-specific differential expression suggests diverse roles of these proteins during plant growth and development. The effect of light and auxin treatment on the transcript levels of OsGH3 genes implies their role in light and auxin signal transduction.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will. We classify rice GH3 proteins in two groups (groups I and II) on the basis of their phylogenetic relationship with Arabidopsis GH3 proteins. Based upon the sequences available in the database, we can not identify a single group III GH3 protein in rice. An extensive survey of EST sequences of other monocots led to the conclusion that although GH3 gene family is highly conserved in both dicots and monocots but the group III is conspicuous by its absence in monocots.

Labs working on this gene

Please input related labs here.

References

Please input cited references here. 1 The auxin-responsive GH3 gene family in rice (Oryza sativa) Functional & Integrative Genomics, 2006, 6(1): 36-46

Structured Information

Gene Name

Os06g0499500

Description

Similar to Indole-3-acetic acid-amido synthetase GH3.17 (EC 6.3.2.-) (Auxin- responsive GH3-like protein 17) (AtGH3-17)

Version

NM_001064239.1 GI:115468209 GeneID:4341111

Length

3752 bp

Definition

Oryza sativa Japonica Group Os06g0499500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:18463909..18467660

Sequence Coding Region

18464228..18464816,18466050..18466901,18467018..18467119,18467225..18467544

Expression

GEO Profiles:Os06g0499500

Genome Context

<gbrowseImage1> name=NC_008399:18463909..18467660 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:18463909..18467660 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgctcctgctgccggagttcgacccggcggacgtccgcgccggccgcgacctcatccaccgcctcaccgccgacgccgccggcatccagcggggcgtcctccgcgagatcctctcccggaactccggcaccgagtacctccgccgcttcctgggcggcgccgccggcgacgacgacgacgtgcgagacgcattcaagaggcgcgtccccgtgtccggctacgaggatgtcaagccgtacgtcgaccgcgtcgcgtccggcggcgagccctcctctgccctcctctgctccgaccccatcacctgcctcagcaggagctccggcacgtccggcgggcagcagaagctgttgccgtccaccgcggaggagctcgacaggaaggtattcttctatgctgtccaggcgctcgtgaggaacatgagcttgcacaccgatcatggtgaagacgacgacggcggtggtggcgagggaatgtacctcatgttcgccttccacggtgaccggacattgtctggcctgcccatccagtctgctctaactacctactaccacagcagacagtttcaggaatgcgacattggcgggtttgataagtgcacaagccccctggaggcaatcctctgcccctatggcgagcagagcatgtactgccagttgctctgtggcctacttcaccgatgcagagtggaccgtgttggtgccagctttgccgctgggttggttcgggggatcaagttcttggaaaatcactgggaggagatgtgcttcaacatccggagcgggcagctcagcgactggatcacgcatactcctctgcgtgatgcggtcactggacagtatcttcaaggatctaacccagctttagccgatgagattgcatccgagtgtgcgaggaaaccttgggatgggatagtcaggaggctatggcctagggcacggtatatccggaccattgtgactggttcaatgtcacagtacattccaattcttgaggtttatggtggcgggctaccgttggtctcaccaatctatgcatctacagaatgcgctgccgggataaatctgaggccacttgatccaccatcccatgtgtcatatgcattgcttccaaacattgcttactttgagttcttggaggtcatggatgaaaatggtgaaaaggtacaaggaactaccaggcttgatgacaatttgggtgaggtaaaagttgttgaccttgtggatgtcaaagttggtcgatgctatgagttgattgtcactacctttgcaggtctttacaggtaccgggtgggtgacctgtttactgtgagtggcttctacaatgcgacgccattgtttcacttctcaggacggcatgatgtcatcctaagcatagattacgagaagataagtgaggaggaccttctcaatgccattgcagaaacagataagttccacctcaggcctcttggctacatgcttgttggtagcactgcatatgcagacatatccactttgcctggccactatatccttttctgggagctgaccaatacctgtgatagcaatgttgccattgacatcgaccaaactgccatggagaagtgttgcttggcagtggaagaccacttcgatgaaatgtaccgcaaaattaggcaccgtggctcaatcagtgcgctcgagataaggattcttagccatggtgcgtttgatgctctgatggacttctttgtgtctagagggacatcagcgagtcaatacaaaactccgacagccattcggtcgaaagaggcgatgatggtattggaggaaagggttgtaggaaggtttttcagccaagcaactcccagctgtcgttcagccgaatttgagaggagataa</cdnaseq>

Protein Sequence

<aaseq>MALLLPEFDPADVRAGRDLIHRLTADAAGIQRGVLREILSRNSG TEYLRRFLGGAAGDDDDVRDAFKRRVPVSGYEDVKPYVDRVASGGEPSSALLCSDPIT CLSRSSGTSGGQQKLLPSTAEELDRKVFFYAVQALVRNMSLHTDHGEDDDGGGGEGMY LMFAFHGDRTLSGLPIQSALTTYYHSRQFQECDIGGFDKCTSPLEAILCPYGEQSMYC QLLCGLLHRCRVDRVGASFAAGLVRGIKFLENHWEEMCFNIRSGQLSDWITHTPLRDA VTGQYLQGSNPALADEIASECARKPWDGIVRRLWPRARYIRTIVTGSMSQYIPILEVY GGGLPLVSPIYASTECAAGINLRPLDPPSHVSYALLPNIAYFEFLEVMDENGEKVQGT TRLDDNLGEVKVVDLVDVKVGRCYELIVTTFAGLYRYRVGDLFTVSGFYNATPLFHFS GRHDVILSIDYEKISEEDLLNAIAETDKFHLRPLGYMLVGSTAYADISTLPGHYILFW ELTNTCDSNVAIDIDQTAMEKCCLAVEDHFDEMYRKIRHRGSISALEIRILSHGAFDA LMDFFVSRGTSASQYKTPTAIRSKEAMMVLEERVVGRFFSQATPSCRSAEFERR</aaseq>

Gene Sequence

<dnaseqindica>2845..3433#760..1611#542..643#117..436#agttccccttcttcctccctgtgcttttcccctttcctttctctgatttctctcaaatgaattactgttaccagttggtgtgattctccagccgaaacttcaccaaccaagcaggaatggcgctcctgctgccggagttcgacccggcggacgtccgcgccggccgcgacctcatccaccgcctcaccgccgacgccgccggcatccagcggggcgtcctccgcgagatcctctcccggaactccggcaccgagtacctccgccgcttcctgggcggcgccgccggcgacgacgacgacgtgcgagacgcattcaagaggcgcgtccccgtgtccggctacgaggatgtcaagccgtacgtcgaccgcgtcgcgtccggcggcgagccctcctctgccctcctctgctccgaccccatcacctgcctcagcaggaggtaaaatttccgcaaatcgggggcggcgttgctccgagttgggataaaccctagctctttgccctcactcacggtaccatctaatttcaatgcgaacggcggcagctccggcacgtccggcgggcagcagaagctgttgccgtccaccgcggaggagctcgacaggaaggtattcttctatgctgtccaggcgctcgtgaggaacatgtaagagcatgactggtgtggtgctttgctcatcattaatcaactggcatattcttgaatttctgtagcaattaacttgctcaattaatatactatattttttgcatttctactaggagcttgcacaccgatcatggtgaagacgacgacggcggtggtggcgagggaatgtacctcatgttcgccttccacggtgaccggacattgtctggcctgcccatccagtctgctctaactacctactaccacagcagacagtttcaggaatgcgacattggcgggtttgataagtgcacaagccccctggaggcaatcctctgcccctatggcgagcagagcatgtactgccagttgctctgtggcctacttcaccgatgcagagtggaccgtgttggtgccagctttgccgctgggttggttcgggggatcaagttcttggaaaatcactgggaggagatgtgcttcaacatccggagcgggcagctcagcgactggatcacgcatactcctctgcgtgatgcggtcactggacagtatcttcaaggatctaacccagctttagccgatgagattgcatccgagtgtgcgaggaaaccttgggatgggatagtcaggaggctatggcctagggcacggtatatccggaccattgtgactggttcaatgtcacagtacattccaattcttgaggtttatggtggcgggctaccgttggtctcaccaatctatgcatctacagaatgcgctgccgggataaatctgaggccacttgatccaccatcccatgtgtcatatgcattgcttccaaacattgcttactttgagttcttggaggtcatggatgaaaatggtgaaaaggtacaaggaactaccaggcttgatgacaatttgggtgaggtaaaagttgttgaccttgtggatgtcaaagttggtcgatgctatgagttgattgtcactacctttgcaggcaagctgttgggctactttttatcccttttttttcagacatggctaggtttatcttatatctgatcattgaaagctctcatcgatttcttgtagctatgcttgcaatcataatttgtgtttcatcgcatttttcaaaatcagttctctccaatgttaggtaaatttattgatatctggataagcatctttcaagacccatgacacctatttaagtcctcaattagcttgtgaatgagaagtccgaaattttatatcctgttatatcagctactatacgtttattatattcaggacacacatttagtggaacaatgcaaatttcgaataattacttcagatcccatggaaaaggcaaaacctaccatttttttacgaaatagcataatgtctgctattaacttcattaatggaggagcatacaaaaacaaggtttaaagttacaagaaaaagatagcacttgaaagttgaaaactcaatcataagtagaatggaccaagaaaaccttagagcaagattctccattaacagtagagcaccatatgagattgtttttttttttctttgttaattgtttccccctcaagttccattacttatatgtagtcctaatggtctattaattggattttgcttgtgtcatcctggctttgttttgcttgtatgatatcctatatttgtaagacaaattttgctacaggacactcaaagtttgtgtaatttgctggtggacatcgtaaaaacgtgccaccgttgaagaacaccctaaaaaactagtaatttgttagatgacatttccagtctaattggggagaaaactcttcaagaagacgagaatgcccatacggccacaagcttctaacctgttgttggagtgaaaatttggaaattatacaactctcaatatccaatcatcccaagtatattccaagcatatctcatatttcatcttcactctagcgctaggttacaggcttgtggctccaggggcattctcatcatttttctctccaattgggctagaaatgtccttgtggcaaattaccagttttttggagtgtcgtctagctgtgacacgtttttgtgatgtccaccagcaaattacacaaacctgtcctgtagcaaaattattgaacaagggtagattccaacattttagaaaaataggattctgaatcagcccaggtaaacaacatcctgtattttgactttgtgacttgtgcatttataataggtctttacaggtaccgggtgggtgacctgtttactgtgagtggcttctacaatgcgacgccattgtttcacttctcaggacggcatgatgtcatcctaagcatagattacgagaagataagtgaggaggaccttctcaatgccattgcagaaacagataagttccacctcaggcctcttggctacatgcttgttggtagcactgcatatgcagacatatccactttgcctggccactatatccttttctgggagctgaccaatacctgtgatagcaatgttgccattgacatcgaccaaactgccatggagaagtgttgcttggcagtggaagaccacttcgatgaaatgtaccgcaaaattaggcaccgtggctcaatcagtgcgctcgagataaggattcttagccatggtgcgtttgatgctctgatggacttctttgtgtctagagggacatcagcgagtcaatacaaaactccgacagccattcggtcgaaagaggcgatgatggtattggaggaaagggttgtaggaaggtttttcagccaagcaactcccagctgtcgttcagccgaatttgagaggagataataattgtactgcctgttcggttggcgtctcggtgacaggagagggcatgttccttatgaaaagttcagtcctgatcacgaataagtggcgcagcattgcaattcgtgcactggagaaggatgatccactcatctccatcttggcacgtcctttttcagtctggaatttggtctcaggagtatcatttcgtgttttcttgtaaattcagaaagaacttctgtactgctccttccacatagcctttgggcgtaactgtagacacaacccttgctccgaggtttataagttacctccgaatttactgattgactgtgttctc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0499500, RefSeq:Os06g0499500

Reference 1The auxin-responsive GH3 gene family in rice (Oryza sativa) Functional & Integrative Genomics, 2006, 6(1): 36-46