Difference between revisions of "Os06g0125800"

From RiceWiki
Jump to: navigation, search
(Function)
Line 3: Line 3:
 
==Annotated Information==
 
==Annotated Information==
 
===Function===
 
===Function===
Please input function information here.
+
1.OsBBI1 modulates broad-spectrum resistance to blast fungus by modifying cell wall defence responses. Disease lesions on the osbbi1 leaves were significantly larger than on the WT leaves after inoculation with two races of M. oryzae. These results indicate that OsBBI1 is required for full immunity in rice against M. oryzae.
 +
 
 +
2.The functional characterization of OsBBI1 provides insight into the E3 ligase-mediated innate immunity, and a practical tool for constructing broad-spectrum resistance against the most destructive disease in rice. The level of protein ubiquitination increased with incubation time, indicating the E3 ligase activity of His-OsBBI1 (Figure 7B). In the presence of Ubi, E1, and E2 enzymes, His-OsBBI1 could carry out self-ubiquitination, while no clear protein ubiquitination was detected in the absence of E1, E2, or HisOsBBI1 (Figure 7C). The truncated mutant, OsBBI1 ∆RING ligase, and the RING domain in OsBBI1 is essential to its E3 Ubi ligase activity.
 +
 
 +
3.Enhancement of cell wall defence response in OsBBI1 overexpression plants
 +
The percentages of autofluorescent cell walls and cross-linking increased by ~10% in the OsBBI1-OE plants compared with that in the WT plants at 24 h.p.i. This increase was much more significant at 48 h.p.i. (Figure 5B and 5D). In contrast, the percentages of autofluorescent cell walls and cross-linking of wall-associated proteins at infection sites were lower in the osbbi1 plants than those in the WT plants at 24 and 48 h.p.i. (Figure 5E and 5F).
  
 
===Expression===
 
===Expression===

Revision as of 00:49, 9 June 2014

OsBBI1, which encoding a RING finger protein with E3 ligase activity, mediates broad-spectrum disease resistance.

Annotated Information

Function

1.OsBBI1 modulates broad-spectrum resistance to blast fungus by modifying cell wall defence responses. Disease lesions on the osbbi1 leaves were significantly larger than on the WT leaves after inoculation with two races of M. oryzae. These results indicate that OsBBI1 is required for full immunity in rice against M. oryzae.

2.The functional characterization of OsBBI1 provides insight into the E3 ligase-mediated innate immunity, and a practical tool for constructing broad-spectrum resistance against the most destructive disease in rice. The level of protein ubiquitination increased with incubation time, indicating the E3 ligase activity of His-OsBBI1 (Figure 7B). In the presence of Ubi, E1, and E2 enzymes, His-OsBBI1 could carry out self-ubiquitination, while no clear protein ubiquitination was detected in the absence of E1, E2, or HisOsBBI1 (Figure 7C). The truncated mutant, OsBBI1 ∆RING ligase, and the RING domain in OsBBI1 is essential to its E3 Ubi ligase activity.

3.Enhancement of cell wall defence response in OsBBI1 overexpression plants The percentages of autofluorescent cell walls and cross-linking increased by ~10% in the OsBBI1-OE plants compared with that in the WT plants at 24 h.p.i. This increase was much more significant at 48 h.p.i. (Figure 5B and 5D). In contrast, the percentages of autofluorescent cell walls and cross-linking of wall-associated proteins at infection sites were lower in the osbbi1 plants than those in the WT plants at 24 and 48 h.p.i. (Figure 5E and 5F).

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0125800

Description

Zinc finger, RING-type domain containing protein

Version

NM_001063188.1 GI:115466107 GeneID:4339966

Length

2362 bp

Definition

Oryza sativa Japonica Group Os06g0125800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:1382622..1384983

Sequence Coding Region

1383074..1383223,1383430..1383673,1383792..1383859,1384044..1384091,1384188..1384312
,1384461..1384569,1384785..1384826

Expression

GEO Profiles:Os06g0125800

Genome Context

<gbrowseImage1> name=NC_008399:1382622..1384983 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:1382622..1384983 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccaccgtggggcagcctgatgccatgagaaggatcaccgttcactacgtgaatccgccgccgatcgccggcgccggagaagcacacgtcgatggcctcgacgacgaggttcttgattatgtgattggtgatgttcttcaggatcaggagggtctgtatcaatcgatattgtatggcaaatacggggatgacatgagaggggcaagaaacactgctcttgcccaatctgatggtttacattactactatcacggagagaacagcagtggtgaagcaacaacctcgagaaattcagaaatcgaccaacagattgagtatgacttggtgttcgctaggcagctgcaggcaatggataatctgacaattgagacacctgcagatgaagatgatgatataagctgcgtaccctctccatctgactctgaaaccgatgaaccggcagaaggcaacaacgaagaggctgccacacaggatgataacgatgatccagacaacatgacatacgagcaaaggcaggcacttgtggaatctgtaggaaatgagaacagaggtttatctgatctgcttatctcctacttggagacatggaagtacaaatcaggctttttcccaaggaaggcaaaccatgataactgtcctatatgtctatccgctttcagacgccgagaaacactcattacattggcttgcaagcatagttaccatgaaggttgtattgctagatggctcaagattgacaaggcctgcccagtttgcaaatatgaagtgtttggaccttcctag</cdnaseq>

Protein Sequence

<aaseq>MATVGQPDAMRRITVHYVNPPPIAGAGEAHVDGLDDEVLDYVIG DVLQDQEGLYQSILYGKYGDDMRGARNTALAQSDGLHYYYHGENSSGEATTSRNSEID QQIEYDLVFARQLQAMDNLTIETPADEDDDISCVPSPSDSETDEPAEGNNEEAATQDD NDDPDNMTYEQRQALVESVGNENRGLSDLLISYLETWKYKSGFFPRKANHDNCPICLS AFRRRETLITLACKHSYHEGCIARWLKIDKACPVCKYEVFGPS</aaseq>

Gene Sequence

<dnaseqindica>453..602#809..1052#1171..1238#1423..1470#1567..1691#1840..1948#2164..2205#aacaaagaatccgtccagccttgagaagcagagaagaggagagaaacaagagacagacagacagagatagagtaactgagtaagcatctcgatcttggcatgttctttcttcttcccctttcccttcattgattctcctcttgttttcctcatcacaaactcctgcagagacctgttcttcacctcaattctgctcttgttatattgcctggattcctttttttttttggttcttggaagcttctattgccgctgcttgttcttgagtgccctctgcaatttatagataattttcttcagtttttttatccaaaaagagttcttggattagttgtaaagaagaggttaaatcaaggaaggttgcatcttgttcttgactgattaattggtgtgccatgatctgcaggtaaacgggttcttgcctgacatttgtcttgtccgggtggccattcatggccaccgtggggcagcctgatgccatgagaaggatcaccgttcactacgtgaatccgccgccgatcgccggcgccggagaagcacacgtcgatggcctcgacgacgaggttcttgattatgtgattggtgatgttcttcaggatcaggtatgcatttgatccaacctttccatcattattagcatactgctcttacaggcttgcagaatgatgagctttagcatcaaacatatgtttctaagcctttgatatggcctctttactttagttcaacattgtttagtaaactttccactgtttctctgaaacttttttgagaataaacttatttgtttttctgaacttttttctaggagggtctgtatcaatcgatattgtatggcaaatacggggatgacatgagaggggcaagaaacactgctcttgcccaatctgatggtttacattactactatcacggagagaacagcagtggtgaagcaacaacctcgagaaattcagaaatcgaccaacagattgagtatgacttggtgttcgctaggcagctgcaggcaatggataatctgacaattgagacacctgcagatgaagatgatggtatgcattcattctcgttcagtttttgtaagcacttgatgtgcataatgattttcagtcgtggcaatcttaatcttttcacctctgaaattttgttgcccatgttggtttgattcagatataagctgcgtaccctctccatctgactctgaaaccgatgaaccggcagaaggcaacaacgaagaggtgattatatgagctgtttcagaattgcaattattcagcattgttcgtttcagacttcttgatgcaaagatacacaattgcgtattcactaaaaagatgagctgtttcagaataaagcctttccaaatggataatgtataaacatgtactacgaaaagttgagattcctatcatttgtttgcaggctgccacacaggatgataacgatgatccagacaacatgacatacgaggttagtgttatattcacttgtatcacatttcttctgtaaaagaggtttacaccatctatgaaaaagttgctgattcttattctttctgtaatccagcaaaggcaggcacttgtggaatctgtaggaaatgagaacagaggtttatctgatctgcttatctcctacttggagacatggaagtacaaatcaggctttttcccaaggaaggcaaaccatgataagtatgtctaccatttcagttttcaatcaatcacatactgatttcttgcagaagataatccaagcatgtaactgatgacactctgattaaaatcttcatcatggcatgcaactgatgatttcctcctcttttttctcccaaaattgcagctgtcctatatgtctatccgctttcagacgccgagaaacactcattacattggcttgcaagcatagttaccatgaaggttgtattgctagatggctcaagattgacaaggtaaacaccttcttgggacactagatttgctatctgaattgtgtacctatcttagattataccatttgtcaaagtttacatgagcactgatatgcactgtccatttcatataacaagatggtctttgtctttcagtttccttgagcttcttccaaattaaaagaacttcatgggcttgtgcagtggaattcctgacatttttgtttatgaaacaggcctgcccagtttgcaaatatgaagtgtttggaccttcctagcgtgtgaggaggcgatcaacaaggctgaccaactatgactcgatgagacggcatatagtggttgcagcatctgctctgcagtattaattaaaaagggaaaccttaactcccaaaaaaaacagagaagggaagaaaaagaaagcaaaaaggaaaaagg</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0125800, RefSeq:Os06g0125800