Difference between revisions of "Os01g0972900"

From RiceWiki
Jump to: navigation, search
(Function)
(Function)
Line 4: Line 4:
 
===Function===
 
===Function===
 
During the whole plant life cycle, cell division and expansion work alternately to build and control the precise size of specific organs (Dupuy et al. 2010). In addition, during cell differentiation of post-embryonic tissue, either cell expansion or endoreduplication control the final size. CCS52 protein has been reported to be involved in cell expansion and endoreduplication, the functional characterization of B-type CCS52 (CCS52B) in plants is relatively limited. Previous studies of model plants (Medicago and Arabidopsis) have proposed that MtCCS52B and AtCCS52B play a crucial role in plant cell division. Yeast overexpressing AtCCS52B had smaller cells compared to the wild type, indicating an early start of the mitotic cell division cycle. Moreover, yeast cells harboring OsCCS52B grow slower than the wild type during the cycle, as determined by the proliferation assay (Fig. 4). Another distinct phenotype is yeast cell elongation prior to division. These results indicate that OsCCS52B may function in cell expansion rather than cell division<ref name="ref1" />.
 
During the whole plant life cycle, cell division and expansion work alternately to build and control the precise size of specific organs (Dupuy et al. 2010). In addition, during cell differentiation of post-embryonic tissue, either cell expansion or endoreduplication control the final size. CCS52 protein has been reported to be involved in cell expansion and endoreduplication, the functional characterization of B-type CCS52 (CCS52B) in plants is relatively limited. Previous studies of model plants (Medicago and Arabidopsis) have proposed that MtCCS52B and AtCCS52B play a crucial role in plant cell division. Yeast overexpressing AtCCS52B had smaller cells compared to the wild type, indicating an early start of the mitotic cell division cycle. Moreover, yeast cells harboring OsCCS52B grow slower than the wild type during the cycle, as determined by the proliferation assay (Fig. 4). Another distinct phenotype is yeast cell elongation prior to division. These results indicate that OsCCS52B may function in cell expansion rather than cell division<ref name="ref1" />.
 +
Although the yeast cell is elongated, the nuclei size remains similar to the wild type, indicating that no additional endoreduplication cycle occurs in OsCCS52B overexpressing cells (Fig. 3). In Arabidopsis, when AtCCS52B is overexpressed in fission yeast, the cells loose polarity control. Therefore, the nuclei location is not always in the center of the cells. In contrast to this phenomenon, the data presented here show that OsCCS52B overexpressing cells maintain the nuclei within the center of the cell.
 +
To further confirm the functional role of OsCCS52B in plants, a T-DNA insertion mutant line 1B-10423 was characterized.The results indicate that OsCCS52B plays an essential role in the growth and development of rice, not only during the early developmental stage, but also during the grain filling stage. In fact OsCCS52B is more likely to be involved in the regulation of cell growth during endosperm development. Taken together with the yeast overexpression data, this result supports the hypothesis for the involvement of OsCCS52B in cell expansion rather than endoreduplication.
  
 
===Expression===
 
===Expression===

Revision as of 06:52, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

During the whole plant life cycle, cell division and expansion work alternately to build and control the precise size of specific organs (Dupuy et al. 2010). In addition, during cell differentiation of post-embryonic tissue, either cell expansion or endoreduplication control the final size. CCS52 protein has been reported to be involved in cell expansion and endoreduplication, the functional characterization of B-type CCS52 (CCS52B) in plants is relatively limited. Previous studies of model plants (Medicago and Arabidopsis) have proposed that MtCCS52B and AtCCS52B play a crucial role in plant cell division. Yeast overexpressing AtCCS52B had smaller cells compared to the wild type, indicating an early start of the mitotic cell division cycle. Moreover, yeast cells harboring OsCCS52B grow slower than the wild type during the cycle, as determined by the proliferation assay (Fig. 4). Another distinct phenotype is yeast cell elongation prior to division. These results indicate that OsCCS52B may function in cell expansion rather than cell division[1]. Although the yeast cell is elongated, the nuclei size remains similar to the wild type, indicating that no additional endoreduplication cycle occurs in OsCCS52B overexpressing cells (Fig. 3). In Arabidopsis, when AtCCS52B is overexpressed in fission yeast, the cells loose polarity control. Therefore, the nuclei location is not always in the center of the cells. In contrast to this phenomenon, the data presented here show that OsCCS52B overexpressing cells maintain the nuclei within the center of the cell. To further confirm the functional role of OsCCS52B in plants, a T-DNA insertion mutant line 1B-10423 was characterized.The results indicate that OsCCS52B plays an essential role in the growth and development of rice, not only during the early developmental stage, but also during the grain filling stage. In fact OsCCS52B is more likely to be involved in the regulation of cell growth during endosperm development. Taken together with the yeast overexpression data, this result supports the hypothesis for the involvement of OsCCS52B in cell expansion rather than endoreduplication.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os01g0972900

Description

Similar to Clone ZZD405 mRNA sequence. (Fragment)

Version

NM_001052078.1 GI:115442526 GeneID:4326397

Length

3262 bp

Definition

Oryza sativa Japonica Group Os01g0972900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:44744264..44747525

Sequence Coding Region

44744407..44744889,44744998..44745225,44745689..44745868,44746003..44746257,44746339..44746443
,44746865..44746927,44747014..44747082,44747159..44747212

Expression

GEO Profiles:Os01g0972900

Genome Context

<gbrowseImage1> name=NC_008394:44744264..44747525 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:44744264..44747525 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgacggacgcgtcccccaagccggcgccgccgcgcctcaacgtgccgccggcgatggcgggggggctccgcctcgatcccgccgtcgcctccccggcccgcctcctcctcgacgtccccaagacgccatccccttccaagaccacgtacagcgaccgcttcatcccctgccgctcctcctcccgcctccacaacttcgccctcctcgaccgcgaccgcgcctccccctcctccaccaccgacgacgccccctactcccgcctcctccgcgccgagatcttcggcccggactccccctccccggctccctcctcccccaacaccaacctcttccgcttcaagaccgaccacccctcgcccaaatcgcccttcgccgcctccgccgccgccaccgccggccactacgactgcaccgccggctccgctgaatcctccacgccgcgcaagccgcccaggaaggtccccaagaccccgcacaaggtcctggacgcgccgtcgctgcaggacgacttctacctcaatcttgtcgactggtcgtcgcagaacacgctcgccgtcggcctcgggaattgcgtctacctctggtcggcttccaattgcaaggtcaccaagctctgcgatttggggcccagggacagcgtctgcgctgtgcactggacccgagaaggctcctatcttgccatcggcaccagccttggcgatgtccagatttgggatagctctcgctgtaaacggattaggaacatgggaggacaccaaacacggactggtgtattagcatggagctcccgaatcttgtcctccggtagcagggacaagaacatattgcagcatgacatccgtgtcccaagtgactatatcagcaagttctcagggcacagatcagaggtctgtggactgaaatggtcgcacgacgaccgtgagcttgcatccggtggaaatgataatcagctgctagtatggaaccaacgttcgcagcagccgatattgaggctgacagaacacacagctgcagttaaagcaatagcatggtcaccacatcagcaaggcctcctggcatcaggtggtggaaccgctgataggtgtatcaggttctggaacacggttaatggaaacatgctgaattcagtggacacaggcagccaggtttgtaatcttgcctggtgtaaaaatgtaaatgagcttgtgagcactcatgggtattcccaaaaccaaatcatggtgtggaagtacccatctatgtcaaaggttgctactctaactggacacacgctgcgagtgctttaccttgcaatgtcacctgatggacagacaatagtaacaggagccggggatgaaaccctcagattttggaatatttttccttcaatgaagacacaggctcctgttcgtgatattgggctctggtcattctcgagaagccacatacggtga</cdnaseq>

Protein Sequence

<aaseq>MATDASPKPAPPRLNVPPAMAGGLRLDPAVASPARLLLDVPKTP SPSKTTYSDRFIPCRSSSRLHNFALLDRDRASPSSTTDDAPYSRLLRAEIFGPDSPSP APSSPNTNLFRFKTDHPSPKSPFAASAAATAGHYDCTAGSAESSTPRKPPRKVPKTPH KVLDAPSLQDDFYLNLVDWSSQNTLAVGLGNCVYLWSASNCKVTKLCDLGPRDSVCAV HWTREGSYLAIGTSLGDVQIWDSSRCKRIRNMGGHQTRTGVLAWSSRILSSGSRDKNI LQHDIRVPSDYISKFSGHRSEVCGLKWSHDDRELASGGNDNQLLVWNQRSQQPILRLT EHTAAVKAIAWSPHQQGLLASGGGTADRCIRFWNTVNGNMLNSVDTGSQVCNLAWCKN VNELVSTHGYSQNQIMVWKYPSMSKVATLTGHTLRVLYLAMSPDGQTIVTGAGDETLR FWNIFPSMKTQAPVRDIGLWSFSRSHIR</aaseq>

Gene Sequence

<dnaseqindica>144..626#735..962#1426..1605#1740..1994#2076..2180#2602..2664#2751..2819#2896..2949#tgaccgttgcaacctcatctccgctcctcttcctcctcctcgtcgtcgttgtcgtcgtcggcggcgcatccagcctcgacgtgccggcggcggtgggtggcggggcagcagacgagcaagaaagagatccctagtctctctcgatggcgacggacgcgtcccccaagccggcgccgccgcgcctcaacgtgccgccggcgatggcgggggggctccgcctcgatcccgccgtcgcctccccggcccgcctcctcctcgacgtccccaagacgccatccccttccaagaccacgtacagcgaccgcttcatcccctgccgctcctcctcccgcctccacaacttcgccctcctcgaccgcgaccgcgcctccccctcctccaccaccgacgacgccccctactcccgcctcctccgcgccgagatcttcggcccggactccccctccccggctccctcctcccccaacaccaacctcttccgcttcaagaccgaccacccctcgcccaaatcgcccttcgccgcctccgccgccgccaccgccggccactacgactgcaccgccggctccgctgaatcctccacgccgcgcaagccgcccaggaaggtccccaagaccccgcacaaggtgggttcccaacgttccttcttccctcttcttgggcatttccacaaacacccactgcgcaactaaaacaatcttttggtttccgatccgtgtgcgtgcgcaactcaggtcctggacgcgccgtcgctgcaggacgacttctacctcaatcttgtcgactggtcgtcgcagaacacgctcgccgtcggcctcgggaattgcgtctacctctggtcggcttccaattgcaaggtcaccaagctctgcgatttggggcccagggacagcgtctgcgctgtgcactggacccgagaaggctcctatcttgccatcggcaccagccttggcgatgtccaggtttccccctctcatctcctctcctctactctctactgaataaattgcctgcagcatatgattgtcttcagtttatctatctagtacttagtagtaattgttttctacactctttagatttcatcacaacaattacacaaactatatacatcaattgttccaaatatcctgaatcctgggctgatgcaattcgcttcgttcaccatctcgtatgatagatgtacactagtaaagatttgaaacataagccctattgctgaaactctaaacttttattcgattctagtactaactatcactatcacaacacgtacatacttctttcaatgtgtccaggatgtgtgcgacagttttgtctgcaaatctcaaactacctatacttgaattagcctattgtttttgttcaactctgtgaatttgttcatggctatcgagaatttgatgcatacataaattccaacagatttgggatagctctcgctgtaaacggattaggaacatgggaggacaccaaacacggactggtgtattagcatggagctcccgaatcttgtcctccggtagcagggacaagaacatattgcagcatgacatccgtgtcccaagtgactatatcagcaagttctcagggcacagatcagaggtgagacttctaactacttccaagccataggtttttggaaaatagctcactaactatgcaagttaaaatcatcccatctcacagtaagatttcagaaccatgtatgtgcatcaagtgacagtttttttggtcaggtctgtggactgaaatggtcgcacgacgaccgtgagcttgcatccggtggaaatgataatcagctgctagtatggaaccaacgttcgcagcagccgatattgaggctgacagaacacacagctgcagttaaagcaatagcatggtcaccacatcagcaaggcctcctggcatcaggtggtggaaccgctgataggtgtatcaggttctggaacacggttaatggaaacatgctgaattcagtggacacaggcagccaggcgagtagttctgaacaagcctctaaaaagtagttcagtgaatttttactgtcatcctcaccagctgctttctgttttcaggtttgtaatcttgcctggtgtaaaaatgtaaatgagcttgtgagcactcatgggtattcccaaaaccaaatcatggtgtggaagtacccatctatgtcaaaggtaagcttaaattcccgtgggctgtcaagcctactaattcaccagttagacaattgtgcatcaagtaatcactcattcggataaaaacgtgaaaaaaagcagaggaagttatgtgtctgatttctcctagggttgtttccaaagaactcattcctttctgtgggccgagacattgactcatggattgcttaaacgcttaaaaggaatttagtatcaacatagttgacgagcatgtaatgcttaaaaagaacaatatcagtatggctgcaaatccaagtgaagtatttcacagggggctattttcatttgtatttgcagataaggataagagtagaataattcctttgaatttttaatatctgttcaagaaagatttccactagtgcagtaccactaagtattttatgttttcgataaacaggttgctactctaactggacacacgctgcgagtgctttaccttgcaatgtcacctgatggacaggtaaatctttttccaaactgcaaatcatgtatccggaaaaatattcctgggaatcgtcctaaatgatgcatattactcatttgcagacaatagtaacaggagccggggatgaaaccctcagattttggaatatttttccttcaatgaagacacaggtaggcatctattgttgaacacagattttatttattttgtggcttgtagcttgaactgccatattgtttgcaccaggctcctgttcgtgatattgggctctggtcattctcgagaagccacatacggtgaccataataggaggcaaagaaaatgcatatgtttgtatgaaacataattttctgaacttgtgcagttcttcagcgatttgtaaattgtgaggcctaattattcatttattgtttgtgtgcgcgtgtgtgtctgtgagatcgagagaaagggagaagaactcatattaacataaccaattctttgtattagaagctcataagtcggctagtttcttgtttggaatttcattgcagagaaacaagggccttgtaatttatcacaaacttatatgcttgtattattctcacacactttgtggccatttcatgacttc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0972900, RefSeq:Os01g0972900

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1