Difference between revisions of "Os05g0322900"
(→Expression) |
(→Expression) |
||
| Line 16: | Line 16: | ||
Full-length cDNA of ''OsWRKY45'' was isolated by RT-PCR using gene-specific primers encompassing the translation start codon and 3’-untranslated regions. The primers are 5’-AGCTGAGCTGCGAGGAAGA-3’ and 5’-CGAAAGCGGAAGAACAGGA-3’. The cDNA sequence has submitted to the NCBI database and the accession number is DQ298181. | Full-length cDNA of ''OsWRKY45'' was isolated by RT-PCR using gene-specific primers encompassing the translation start codon and 3’-untranslated regions. The primers are 5’-AGCTGAGCTGCGAGGAAGA-3’ and 5’-CGAAAGCGGAAGAACAGGA-3’. The cDNA sequence has submitted to the NCBI database and the accession number is DQ298181. | ||
| − | The expression of the ''OsWRKY45'' gene is investigated using RT-PCR in rice leaves infected with the avirulent M. grisea strain PO6-6 on RIL260. The expression profiling analysis revealed that the transcript levels of ''OsWRKY45'' is significantly increased by pathogen treatment.<ref name="ref5" />[[File: | + | The expression of the ''OsWRKY45'' gene is investigated using RT-PCR in rice leaves infected with the avirulent M. grisea strain PO6-6 on RIL260. The expression profiling analysis revealed that the transcript levels of ''OsWRKY45'' is significantly increased by pathogen treatment.<ref name="ref5" />[[File:[[File:expression profiles of oswrky genes following m.grisea infection.png|right|thumb|150px|''Expression profiles of OsWRKY genes following M. grisea infection (from reference <ref name="ref5" />).'']] |
===Evolution=== | ===Evolution=== | ||
Revision as of 12:10, 9 June 2014
Please input one-sentence summary here.
Contents
Annotated Information
OsWRKY45 is a member of the WRKY transcription factor family. The WRKY transcription factors in plant play important roles and act wildly in response to varies biotic and antibiotic stresses.
Function
A number of WRKY-type transcription factors from different plant species have been identified to play important roles in host-pathogen interactions. These WKRYs function either as positive or negative regulators in defense responses. Some WRKYs are both positive and negative regulators in different defense responses. Some other WRKYs have partly redundant functions in defense signaling.[1]
OsWRKY45, according to the rice genome annotation of The Institute for Genomic Research(http://rice.tigr.org) functioned downstream of OsWRKY13. Activation of OsWRKY13 repressed OsWRKY45 expression, and suppression of OsWRKY13 enhanced OsWRKY45 expression; furthermore, Xanthomonas oryzae pv oryzae(Xoo) infection influenced OsWRKY45 expression. These suggest that OsWRKY45 may be involved in rice-Xoo interactions.[1]
In addition, one study shows that OsWRKY45 transcription factor plays a crucial role in benzothiadiazole-inducible blast resistance. The RNA interference-mediated knockdown of OsWRKY45 compromised BTH-inducible resistance to blast disease, indicating that it is essential for BTH-induced defense responses.[2] another study shows that overexpressing OsWRKY45 in Arabidopsis enhanced resistance to the bacterial pathogen Pseudomonas syringae tomato and enhanced tolerance to salt and drought stresses and this gene may be involved in the signal pathways of both biotic and abiotic stress response. [3]
There are two alleles of OsWRKY45 functioned differently in rice-pathogen interactions. The allele[2] from japonica rice var Nipponbare is called OsWRKY45-1 and the alleles from indica rice var Minghui63 is called OsWRKY45-2. This pair of allelic genes encode proteins with a 10-amino acid difference, play opposite roles in rice (oryza sativa) resistance against bacterial pathogens. OsWRKY45-1-overexpressing plants showed increased susceptibility and OsWRKY45-1-knockout plants showed enhanced resistance to Xoo. OsWRKY45-2-overexpressing plants showed enhanced resistance and OsWRKY45-2-suppressing plants showed increased susceptibility to Xoo. Both OsWRKY45-1- and OsWRKY45-2 expressing plants showed enhanced resistance to M.grisea. OsWRKY45-1-regulated Xoo resistance was accompanied by increased accumulation of salicylic acid and jasmonic acid and induced expression of a subset of defense-responsive genes, while OsWRKY45-2-regulated Xoo resistance was accompanied by increased accumulation of jasmonic acid but not salicylic acid and induced expression of another subset of defense-responsive genes. These results suggest that both OsWRKY45-1and OsWRKY45-2 are positive regulators in rive resistance against M. grisea, but the former is a negative regulator and the latter is a positive regulator in rice resistance against Xoo . The opposite roles of the two allelic genes in rice-Xoo interaction appear to be due to their mediation of different defense signaling pathways.[1]
Expression
Full-length cDNA of OsWRKY45 was isolated by RT-PCR using gene-specific primers encompassing the translation start codon and 3’-untranslated regions. The primers are 5’-AGCTGAGCTGCGAGGAAGA-3’ and 5’-CGAAAGCGGAAGAACAGGA-3’. The cDNA sequence has submitted to the NCBI database and the accession number is DQ298181.
The expression of the OsWRKY45 gene is investigated using RT-PCR in rice leaves infected with the avirulent M. grisea strain PO6-6 on RIL260. The expression profiling analysis revealed that the transcript levels of OsWRKY45 is significantly increased by pathogen treatment.[4][[File:Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Structured Information
| Gene Name |
Os05g0322900 |
|---|---|
| Description |
Similar to WRKY transcription factor 45 |
| Version |
NM_001061727.1 GI:115463184 GeneID:4338413 |
| Length |
2144 bp |
| Definition |
Oryza sativa Japonica Group Os05g0322900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 5:14969394..14971537 |
| Sequence Coding Region |
14969506..14969813,14970407..14970511,14970613..14971180 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008398:14969394..14971537 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008398:14969394..14971537 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgacgtcatcgatgtcgccggcgccggcgccggcgtacgcgcaggtgatggaggacatggagaaggggaaggagctggcggcgcagctgcaggggctcctccgcgactcgccggaggccggccgcttcgtcgaccagattctccacaccttctcccgggcgatgcgggcgctcgacaaggcggcggtctccgccgccggaggagaagggtcggaggtgcagagcgaggtcacctgcgggggcggggccagcgccggcgggaagaggaaagcccccgccgccgaccggaaggccaactgccgcaggaggacgcagcaatcgtccgggaattcggtggtcgtcaagaacctcgacgacggccaggcatggcgcaagtacgggcagaaggagatccaaaactccaagcacccaaaggcctacttccggtgcacgcacaagtacgaccagctgtgcacggcgcagcggcaggtgcagcgctgcgacgacgacccggcgagctacagggtcacctacatcggcgagcacacctgccgggacccggccaccgcccccatcatcgcggcgcacgtcatccaccaggtcgccgccggcgacaacgacgacggctgcggcggcctccaagcggggtcccgcctcatcagcttcgtcgccgcgccggcggcgccagtagacgctgccgcggcgccgacgaccagcacgatcaccacggtcaccgcgccgggcccgctgctgcagccgctcaaggtggagggcggcgtcggctcgtccgaccaggaggaggtgctgagcagcctcacgcccggcagctccgcggcgcgcggcggcggcggcggcggcggagtcgcgggtcccttcgggccggaccagggcgatgtcacgtcctccctgcactggagctacgacgccgtcgccggcatggagttcttcaagaacgacgaggttgtcttcgatctggacgacattatgggtttgagcttttga</cdnaseq> |
| Protein Sequence |
<aaseq>MTSSMSPAPAPAYAQVMEDMEKGKELAAQLQGLLRDSPEAGRFV DQILHTFSRAMRALDKAAVSAAGGEGSEVQSEVTCGGGASAGGKRKAPAADRKANCRR RTQQSSGNSVVVKNLDDGQAWRKYGQKEIQNSKHPKAYFRCTHKYDQLCTAQRQVQRC DDDPASYRVTYIGEHTCRDPATAPIIAAHVIHQVAAGDNDDGCGGLQAGSRLISFVAA PAAPVDAAAAPTTSTITTVTAPGPLLQPLKVEGGVGSSDQEEVLSSLTPGSSAARGGG GGGGVAGPFGPDQGDVTSSLHWSYDAVAGMEFFKNDEVVFDLDDIMGLSF</aaseq> |
| Gene Sequence |
<dnaseqindica>113..420#1014..1118#1220..1787#tgctttgagctccatcaccagctgagctgcgaggaagagagagtgcgagagtgcgcggcagcggcagtgtagtgtcagtcactgggtgtgcgcttgcttgcttggattgaggatgacgtcatcgatgtcgccggcgccggcgccggcgtacgcgcaggtgatggaggacatggagaaggggaaggagctggcggcgcagctgcaggggctcctccgcgactcgccggaggccggccgcttcgtcgaccagattctccacaccttctcccgggcgatgcgggcgctcgacaaggcggcggtctccgccgccggaggagaagggtcggaggtgcagagcgaggtcacctgcgggggcggggccagcgccggcgggaagaggaaagcccccgccgccgaccggaaggccaactgccgcaggaggtgagaacgaaggccagagcatagctcatcacaaagcatagcatcatctgtgtgtaattagctgcgttctttcagggaagataggggggattgtccctcgttttccgcgcgcacgcttttcaaactactatacggtgcgtttttcgtataaattttctataggaaagttgctttaaaaaatcatattaatccatttttgaagtttcaaaatcataaaatcatgcgctaatggttcacctcgttttgcgtatattcccaatcttctctatttccttctcctcaaacacagcctgggagtgtttgagaaggggattgaggagattgggaagatacgtaaaacgaggtgagccattagctcatgattaattgagtattaactattttaaattttaaaaatagattaatatgattttttaaagcaactttcctatagaaattttttgcaaaaaacgtaccgtttaatagtttgaaaagcgtgcgcgcggaaaacgagagccaatctcccctatcacccctaaacgaacgataccttccctatcacccctaaacgaacgataccttaatgtactaagatttgtgtgtacgtattgcaggacgcagcaatcgtccgggaattcggtggtcgtcaagaacctcgacgacggccaggcatggcgcaagtacgggcagaaggagatccaaaactccaagcacccaaagtgagtagacttgtcccgacaaaaaacaatgtgttcgagactgtacagttggatgcgttgcgcgctgacgaggagttgtttggggtatgctacgtgtacagggcctacttccggtgcacgcacaagtacgaccagctgtgcacggcgcagcggcaggtgcagcgctgcgacgacgacccggcgagctacagggtcacctacatcggcgagcacacctgccgggacccggccaccgcccccatcatcgcggcgcacgtcatccaccaggtcgccgccggcgacaacgacgacggctgcggcggcctccaagcggggtcccgcctcatcagcttcgtcgccgcgccggcggcgccagtagacgctgccgcggcgccgacgaccagcacgatcaccacggtcaccgcgccgggcccgctgctgcagccgctcaaggtggagggcggcgtcggctcgtccgaccaggaggaggtgctgagcagcctcacgcccggcagctccgcggcgcgcggcggcggcggcggcggcggagtcgcgggtcccttcgggccggaccagggcgatgtcacgtcctccctgcactggagctacgacgccgtcgccggcatggagttcttcaagaacgacgaggttgtcttcgatctggacgacattatgggtttgagcttttgatcaccgaagaatcatggatggacacgggccgggtaaaacgatcgaaagaagatggattccacgcgtgtgtacagaaataattagcggcagcgcggatcttaatttggaacttgcaaagatactcctaattagcctggctagattagtttgtaaattccttgttgatgtgtcgtctcagctttaagctgcagacatgctagcaagtaacaacacgattagtacgtagtaatgtggttcttgattatgagctgggggtcttaaccttttttgtgtgacaagcaagagaagaggatttgggtacaatgtaatcctgttcttccgctttcgaaaaaaaaaaacatatagcttcacgtgcct</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 1.3 Cite error: Invalid
<ref>tag; no text was provided for refs namedref1 - ↑ 2.0 2.1 Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ 3.0 3.1 Cite error: Invalid
<ref>tag; no text was provided for refs namedref3 - ↑ 4.0 4.1 Cite error: Invalid
<ref>tag; no text was provided for refs namedref5 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref4