Difference between revisions of "Os02g0181300"

From RiceWiki
Jump to: navigation, search
(Annotated Information)
(Expression)
Line 8: Line 8:
 
===Expression===
 
===Expression===
 
The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR (data not shown). To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers (Fig. 1b). Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls (Fig. 2a). Four transgenic lines showed silencing of all four genes, called supersilencing, as expected (Fig. 2b), and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines.
 
The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR (data not shown). To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers (Fig. 1b). Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls (Fig. 2a). Four transgenic lines showed silencing of all four genes, called supersilencing, as expected (Fig. 2b), and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines.
 
  
 
===Evolution===
 
===Evolution===

Revision as of 17:10, 9 June 2014

Please input one-sentence summary here.

Annotated Information

Function

WRKY proteins constitute a family of mostly plant-specific zinc-finger transcription factors composed of 74 and 109 members in Arabidopsis and rice, respectively.A common feature of WRKY proteins is the WRKY domain, which is defined by a region of approximately 60 amino acids containing a conserved WRKYGQK amino acid sequence adjacent to a zinc-finger-like motif.Both regions are necessary for high-affinity binding to a canonical Wb-box motif containing a consensus sequence (C/T)TGAC (C/T). Based on primary structure, WRKY proteins have been classified into three groups (I, II, and III) and various subgroups (e.g., IIa, IIb, etc.)

Expression

The WRKYssRNAi construct was introduced into Kitaake plants by Agrobacterium-mediated transformation. The presence of the transgene in individually transformed plants was confirmed by PCR (data not shown). To determine the RNA levels of the endogenous OsWRKY IIa genes, real-time polymerase chain reaction (RT-PCR) was performed on RNA samples from 17 transgenic lines using gene-specific primers (Fig. 1b). Surprisingly, super-overexpression of all four genes was observed in nine transgenic lines when compared to the wild type controls (Fig. 2a). Four transgenic lines showed silencing of all four genes, called supersilencing, as expected (Fig. 2b), and four lines showed little change in gene expression relative to the controls. To ensure that the inserted construct is transcribed as expected, the gus linker expression was examined using RTPCR. As shown in Fig. 2, the gus linker expression was detected in all 17 transgenic lines.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os02g0181300

Description

WRKY transcription factor 71 (Transcription factor WRKY09)

Version

NM_001052629.1 GI:115444628 GeneID:4328512

Length

1393 bp

Definition

Oryza sativa Japonica Group Os02g0181300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:4543031..4544423

Sequence Coding Region

4543031..4543177,4543287..4543709,4543836..4543952,4544064..4544423

Expression

GEO Profiles:Os02g0181300

Genome Context

<gbrowseImage1> name=NC_008395:4543031..4544423 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:4543031..4544423 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatccgtggattagcacccagccttcgctgagcctggacctccgcgtcgggctgccggcgacggcggccgtcgccatggttaagcccaaggtgctcgtcgaggaggacttctttcaccagcagcctctcaagaaagacccagaggttgcggcgctggaggcggagctgaagcggatgggcgcggagaaccggcagctgagcgagatgctggcggcggtggcggccaagtacgaggcgctgcagagccagttcagcgacatggtcaccgccagcgccaacaacggcggcggcggcggcaacaacccgtcgtccacctccgagggcggctccgtctcgccgtcgaggaagcgcaagagcgagagcctcgacgactccccgccgccgccgccgccgccgcacccacacgcggcgccgcaccacatgcacgtcatgcccggcgccgccgccgccggctacgccgaccagaccgagtgcacctccggcgagccctgcaagcgcatccgcgaggagtgcaagcccaagatctccaagctctacgtccacgccgacccatccgacctcagcctggtggtgaaagatgggtaccaatggaggaagtatggtcagaaggtcaccaaggacaacccctgcccaagagcctacttcagatgctcatttgctcccgcctgccctgtcaagaagaaggttcagagaagcgcggaggacaacacgatcctcgtggcgacgtacgagggggagcacaaccacggccagccgccgccgccgctgcagtcggcggcgcagaacagcgacggctccggcaagagcgccgggaagccaccccatgcgccggcggcggcgccgccggcgccggtggtgccgcaccgtcagcacgaaccggtcgtcgtcaacggcgagcagcaggccgcggcggcgtcggagatgatcaggcggaacctggccgagcagatggcgatgacgctgacgcgtgacccaagcttcaaggcggcgctcgtcaccgccctctccggccgcatcctcgagctctcgccgaccaaggattga</cdnaseq>

Protein Sequence

<aaseq>MDPWISTQPSLSLDLRVGLPATAAVAMVKPKVLVEEDFFHQQPL KKDPEVAALEAELKRMGAENRQLSEMLAAVAAKYEALQSQFSDMVTASANNGGGGGNN PSSTSEGGSVSPSRKRKSESLDDSPPPPPPPHPHAAPHHMHVMPGAAAAGYADQTECT SGEPCKRIREECKPKISKLYVHADPSDLSLVVKDGYQWRKYGQKVTKDNPCPRAYFRC SFAPACPVKKKVQRSAEDNTILVATYEGEHNHGQPPPPLQSAAQNSDGSGKSAGKPPH APAAAPPAPVVPHRQHEPVVVNGEQQAAAASEMIRRNLAEQMAMTLTRDPSFKAALVT ALSGRILELSPTKD</aaseq>

Gene Sequence

<dnaseqindica>1..147#257..679#806..922#1034..1393#atggatccgtggattagcacccagccttcgctgagcctggacctccgcgtcgggctgccggcgacggcggccgtcgccatggttaagcccaaggtgctcgtcgaggaggacttctttcaccagcagcctctcaagaaagacccagaggtaggtcatgtgattaagcatacgtgcacggacgatcgacggccgccatggctgggagcgtgatgagcttaatttcttgagctgatttggggttttttttgttgtgaaggttgcggcgctggaggcggagctgaagcggatgggcgcggagaaccggcagctgagcgagatgctggcggcggtggcggccaagtacgaggcgctgcagagccagttcagcgacatggtcaccgccagcgccaacaacggcggcggcggcggcaacaacccgtcgtccacctccgagggcggctccgtctcgccgtcgaggaagcgcaagagcgagagcctcgacgactccccgccgccgccgccgccgccgcacccacacgcggcgccgcaccacatgcacgtcatgcccggcgccgccgccgccggctacgccgaccagaccgagtgcacctccggcgagccctgcaagcgcatccgcgaggagtgcaagcccaagatctccaagctctacgtccacgccgacccatccgacctcagcctggtacgaatccccaaccccaattaacatccgatcatctcatttcatgtgcctaacttaacttctttttgttctgaattctagccttgattaattaattaatcctgttcttgcaatgaatccatgcaggtggtgaaagatgggtaccaatggaggaagtatggtcagaaggtcaccaaggacaacccctgcccaagagcctacttcagatgctcatttgctcccgcctgccctgtcaagaagaaggtaacttaaattcctctaactaattccaaagtgatttcgtaagttttgctaaatttagtgcaaattcgagcctgtttctgaactttgttcgtggttcaaatgttgtttcaggttcagagaagcgcggaggacaacacgatcctcgtggcgacgtacgagggggagcacaaccacggccagccgccgccgccgctgcagtcggcggcgcagaacagcgacggctccggcaagagcgccgggaagccaccccatgcgccggcggcggcgccgccggcgccggtggtgccgcaccgtcagcacgaaccggtcgtcgtcaacggcgagcagcaggccgcggcggcgtcggagatgatcaggcggaacctggccgagcagatggcgatgacgctgacgcgtgacccaagcttcaaggcggcgctcgtcaccgccctctccggccgcatcctcgagctctcgccgaccaaggattga</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0181300, RefSeq:Os02g0181300