|
|
| Line 34: |
Line 34: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os06g0127100|
| |
| − | Description = Similar to CBF-like protein|
| |
| − | Version = NM_001063196.1 GI:115466123 GeneID:4339974|
| |
| − | Length = 764 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os06g0127100, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 6|Chromosome 6]]|
| |
| − | AP = Chromosome 6:1433771..1434534|
| |
| − | CDS = 1433798..1434442|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008399:1433771..1434534
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008399:1433771..1434534
| |
| − | source=RiceChromosome06
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactga</cdnaseq>|
| |
| − | AA = <aaseq>MEYYEQEEYATVTSAPPKRPAGRTKFRETRHPVYRGVRRRGPAG RWVCEVREPNKKSRIWLGTFATAEAAARAHDVAALALRGRGACLNFADSARLLRVDPA TLATPDDIRRAAIELAESCPHDAAAAAASSSAAAVEASAAAAPAMMMQYQDDMAATPS SYDYAYYGNMDFDQPSYYYDGMGGGGEYQSWQMDGDDDGGAGGYGGGDVTLWSY</aaseq>|
| |
| − | DNA = <dnaseqindica>28..672#ccagcagcagcaacacacactactgacatggagtactacgagcaggaggagtacgcgacggtgacgtcggcgccgccgaagcggccggcggggaggaccaagttcagggagacgaggcacccggtgtaccgcggcgtgcggcggcgggggcccgcggggcggtgggtgtgcgaggtcagggagcccaacaagaagtcccgcatctggctcggcaccttcgccaccgccgaggccgccgcgcgcgcccacgacgtcgccgcgctcgccctccgcggccgcggcgcgtgcctcaacttcgccgactcggcccgcctcctccgcgtcgacccggccaccctcgccacccccgacgacatccgccgcgccgccatcgagctcgccgagtcatgcccgcacgacgccgccgccgccgccgcctccagctccgccgccgccgtcgaggcctccgccgccgccgcgcccgccatgatgatgcagtaccaggacgacatggcggcgacgccgtccagctacgactacgcgtactacggcaacatggacttcgaccagccgtcctactactacgacgggatgggcggcggcggcgagtaccagagctggcagatggacggcgacgacgatggtggcgccggcggctacggcggcggcgacgtcacactctggagctactgatgatcgcgagttggagctagcagttttgagctcaaccagctttgctcctcctatacagctaaatactgtaggagaaattaatggagattttt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001063196.1 RefSeq:Os06g0127100]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Revision as of 08:02, 12 June 2015
Please input one-sentence summary here.
Annotated Information
Function
Conserved amino acid residues and phylogeny construction using the AP2/ERF conserved domain sequence suggest that in rice the OsAP2/EREBP gene family can be classified broadly into four subfamilies [AP2, RAV (related to ABI3/VP1), DREB(dehydration-responsive element-binding protein) and ERF (ethylene-responsive factor)](Akhter Most Sharoni, 2010).The chromosomal localizations of the OsAP2/EREBP genes indicated 20 segmental duplication events involving 40 genes; 58 redundant OsAP2/EREBP genes were involved in tandem duplication events(Akhter Most Sharoni, 2010). Os06g0127100 comprises a large group of plantspecific transcription factors and is involved in abiotic stress response.It is highly up-regulated in both genotypes, which is consistent with previous reports that these DREBs/CBFs contribute to low temperature stress response by regulating many transcriptomic and metabolic changes(Zhang, 2012).
Expression
In the vegetative organs, the transcripts of the gene are found most abundant in the roots followed by the leaf and stem; whereas, in reproductive tissues,the gene expression is observed high in the embryo and lemma.It comprises a large group of plantspecific transcription factors and is involved in abiotic stress response(Muhammad rashid, 2012).
Relationships among rice AP2/EREBP proteins after alignment with ClustalW. OsAP2/EREBP proteins were allocated to two distinct subfamilies (DREB, subgroups A-1 to A-6; ERF, subgroups B-1 to B-7).
Fig1.Relationships among rice AP2/EREBP proteins after alignment with ClustalW. OsAP2/EREBP proteins were allocated to two distinct subfamilies (DREB, subgroups A-1 to A-6; ERF, subgroups B-1 to B-7). (from reference [1]).
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
(A) Evolutionary relationships among rice AP2/EREBP domain sequences. The unrooted tree was generated by the Neighbor–Joiningmethod with the ClustalX program. Domains a and b were found in subfamilies RAV and AP2, e.g. in Os01g59780a and Os01g59780b, respectively.The RAV subfamily showed motif duplication, and the AP2 subfamily showed domain duplication. (B) Structure of AP2/EREBP genes (from reference
[1]).
Labs working on this gene
Please input related labs here.
Conceived and designed the experiments: BF DY. Performed the experiments: TZ XZ WW YP LH XL LZ. Analyzed the data: TZ BF. Contributed reagents/materials/analysis tools: LZ YZ. Wrote the paper:BF TZ DY.
References
Please input cited references here.
1. Sharoni Akhter Most, Nuruzzaman Mohammed, Satoh Kouji, Shimizu Takumi, Kondoh Hiroaki, Sasaya Takahide, Choi Il-Ryong, Omura Toshihiro, Kikuchi Shoshi. Gene Structures Classification Expression Models of the AP2 EREBP Transcription Factor Family in Rice[J]. Plant and Cell Physiology , 2010-2 .
2. Zhang Ting, Zhao Xiuqin, Wang Wensheng, Pan Yajiao, Huang Liyu, Liu Xiaoyue, Zong Ying, Zhu Linghua, Yang Daichang, Fu Binying. Comparative Transcriptome Profiling of Chilling Stress Responsiveness in Two Contrasting Rice Genotypes[J], 2012-8.
3. Rashid M, Guangyuan H, Guangxiao Y, etal. AP2/ERF Transcription Factor in Rice: Genome-Wide Canvas and Syntenic Relationships between Monocots and Eudicots[J], 2012-6.
Structured Information
- ↑ 1.0 1.1 Cite error: Invalid
<ref> tag;
no text was provided for refs named Akhter_Most_Sharoni