|
|
| Line 33: |
Line 33: |
| | | | |
| | ==Structured Information== | | ==Structured Information== |
| − | {{JaponicaGene|
| |
| − | GeneName = Os09g0459200|
| |
| − | Description = Conserved hypothetical protein|
| |
| − | Version = NM_001069915.1 GI:115479572 GeneID:4347276|
| |
| − | Length = 1474 bp|
| |
| − | Definition = Oryza sativa Japonica Group Os09g0459200, complete gene.|
| |
| − | Source = Oryza sativa Japonica Group
| |
| | | | |
| − | ORGANISM Oryza sativa Japonica Group
| |
| − | Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
| |
| − | Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
| |
| − | clade; Ehrhartoideae; Oryzeae; Oryza.
| |
| − | |
| |
| − | Chromosome = [[:category:Japonica Chromosome 9|Chromosome 9]]|
| |
| − | AP = Chromosome 9:18004651..18006124|
| |
| − | CDS = 18004776..18005216,18005552..18005584|
| |
| − | GCID = <gbrowseImage1>
| |
| − | name=NC_008402:18004651..18006124
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage1>|
| |
| − | GSID = <gbrowseImage2>
| |
| − | name=NC_008402:18004651..18006124
| |
| − | source=RiceChromosome09
| |
| − | preset=GeneLocation
| |
| − | </gbrowseImage2>|
| |
| − | CDNA = <cdnaseq>atggcatgtgttaacatgtacaacccggagcatcaccaccaccagtcgtcgtcgttcatggcgccgaggatatccttttccagcgacttcgcgctcgagccgccgccgccggcgcagcagcagccggcggtgcgggcgcctggggacgccgacttcgagttctccgtcggcagccacccgatgatggccgccgaccagctgatctccaagggccgcctcctgccgctccgggaggccccgcacggccacggcggcgccgacgccggcggccggccactcacgctccgcgacgagctgcgcacggacagccgccatggccgcgtcccccgcgcgcccaacattcggtggaaggagttcctcggcctcaagaaggcgcccaagaaggcccccaccgccgacgctgccgccggcgccacatcgtcgtcggccgacacccagatggatcttggaggtcaagggagcacgagagactga</cdnaseq>|
| |
| − | AA = <aaseq>MACVNMYNPEHHHHQSSSFMAPRISFSSDFALEPPPPAQQQPAV RAPGDADFEFSVGSHPMMAADQLISKGRLLPLREAPHGHGGADAGGRPLTLRDELRTD SRHGRVPRAPNIRWKEFLGLKKAPKKAPTADAAAGATSSSADTQMDLGGQGSTRD</aaseq>|
| |
| − | DNA = <dnaseqindica>126..566#902..934#attctccatagcttggccaccgtagtaaagccggcgagctaattctagttctagccagctacacgagatcatcgctgtgacgggcggggcattgagagggcgcgtgtgccggccggggtcgatgcatggcatgtgttaacatgtacaacccggagcatcaccaccaccagtcgtcgtcgttcatggcgccgaggatatccttttccagcgacttcgcgctcgagccgccgccgccggcgcagcagcagccggcggtgcgggcgcctggggacgccgacttcgagttctccgtcggcagccacccgatgatggccgccgaccagctgatctccaagggccgcctcctgccgctccgggaggccccgcacggccacggcggcgccgacgccggcggccggccactcacgctccgcgacgagctgcgcacggacagccgccatggccgcgtcccccgcgcgcccaacattcggtggaaggagttcctcggcctcaagaaggcgcccaagaaggcccccaccgccgacgctgccgccggcgccacatcgtcgtcggccgacacccagatggtaataacaagctcactgtttcttgcgccatgaatgcactctgctacagctctgcattgtcccattttgcttgtcgcattgcaacatttttcgaatcttcaaaaacaccctgcttgctgcaagaccctcctgcgcagtagagtacaagcactttctgcttcaaagatttctcaaagtttggagcctgagatagatgtgcattgcatgcatgtactactcatgcattgctaaccaccagaaccagattgcacagaaattttagcggcacaactactcatgcattgttaaccattttcctgctgaagtgacaacaaaatgtatgcaaaaccctgtaggatcttggaggtcaagggagcacgagagactgaagcaacaaacgcaatgaagtgtattactgatcaatgagtactacgtagtagtgaaactgaagtagccatggttggccagatcggatgcatggtggcgatgcgcctttcagcttgctgtctgccatcactcatattcactcttgctgatgatcttagcagctcattctaatggagaactctgcagggcaaatggccatttccttttacctctttgctgcatcttttttgggtgtaaaagggaattttgatctctagtttttgggtaatggtcgtcgtcgggtagatgggtggttccagtgtagtcaaattaactccgctgcgcctctgatgttttgtattggaagggccagtaaaaatgtatttttccccacatggtgtggtcctagcttagcttttgtacgtgttgtttagctgttcccatgcttgtctgcttccgccacctccgctctctcccccactttccctatgtacaaaaatgcttgtaatctagtagtagctagcaattcaagctttcagttcaatgaagcccatttcaacgtt</dnaseqindica>|
| |
| − | Link = [http://www.ncbi.nlm.nih.gov/nuccore/NM_001069915.1 RefSeq:Os09g0459200]|
| |
| − | }}
| |
| | [[Category:Genes]] | | [[Category:Genes]] |
| | [[Category:Japonica mRNA]] | | [[Category:Japonica mRNA]] |
Revision as of 09:46, 12 June 2015
Please input one-sentence summary here.
Annotated Information
Function
"Figure 1. Identification of the rice SG1 gene by activation tagging. (from reference
[1]）."
SHORT GRAIN1 (SG1) controls the elongation of both grains and internodes in rachis branches.
Overexpression of SG1 in rice produced a phenotype with short grains and dwarfing reminiscent
of brassinosteroid (BR)-deficient mutants, with wide, dark-green, and erect leaves.SG1 decreases organ elongation by decreasing cell proliferation and also decreases responses
to BRs and elongation of organs such as seeds and the internodes of rachis branches through
decreased cellular proliferation[1]
Expression
"Figure 2. Expression analysis of SG1 using qPCR and SG1::GUS transgenic plants. . (from reference
[1]）."
During vegetative growth,SG1 was preferentially expressed in the roots. During reproductive growth, SG1 was strongly expressed in the young panicles (0.3–1 cm in length), and expression then gradually decreased as the panicles matured. In the developing panicles, SG1 was expressed most strongly in the spikelets and the basal parts of rachis and rachis branches.
SG1 encodes a novel protein that is conserved among angiosperms.SG1 does not share significant identity with any proteins of known function.
However, SG1 and related proteins comprise a family that is conserved among monocots and dicots. The rice genome encodes two SG1-related proteins (Os02g0762600 and Os08g0474100) that have 49% to 53% sequence identity with SG1.[1]
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
- National Institute of Agrobiological Sciences
- Graduate School of Science and Technology
- Tokyo University of Science
- RIKEN Advanced Science Institute
References
- ↑ 1.0 1.1 1.2 1.3 Hitoshi Nakagawa, Atsunori Tanaka, Takanari Tanabata, Miki Ohtake, Shozo Fujioka, et al. short GRAIN1 decreases organ elongation and brassinosteroid response in rice.Plant Physiol 2012 158:1208-19.
Structured Information
