Difference between revisions of "Os09g0470500"

From RiceWiki
Jump to: navigation, search
(→‎Evolution)
(→‎References)
Line 23: Line 23:
  
 
==References==
 
==References==
−
Please input cited references here.
+
<references>
 +
<ref name="ref1">Adamantia Agalou, Sigit Purwantomo, Elin O¨verna¨s et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members Plant Mol Biol (2008) 66:87–103.</ref>
 +
<ref name="ref2">Sessa G, Carabelli M, Ruberti I (1994) Identification of distinct families of HD-Zip proteins inArabidopsis thaliana. In: Coruzzi GP (ed) Plant molecular biology. Springer-Verlag, Berlin, pp 412–426.</ref>
 +
<ref name="ref3">A. H. Meijer, R. J. de Kam, I. d'Erfurth, W. Shen, J. H. C. Hoge. HD-Zip proteins of families I and II from rice: interactions and functional properties. Molecular and General Genetics MGG, February 2000, Volume 263, Issue 1, pp 12-21.</ref>
 +
<ref name="ref4">Mingqiu Dai, Yongfeng Hu, Qian Ma, Yu Zhao, Dao-Xiu Zhou. Functional analysis of rice HOMEOBOX4 (Oshox4) gene reveals a negative function in gibberellin responses. Plant Mol Biol (2008) 66:289–301.</ref>
 +
<ref name="ref5">Dai M, Zhao Y, Ma Q, Hu Y, Hedden P, Zhang Q, Zhou DX (2007a) The rice ''YABBY1'' gene is involved in the feedback regulation of gibberellin metabolism. Plant Physiol 144:121–133.</ref>
 +
<ref name="ref6">Alabadi D, Gil J, Blazquez MA, Garcia-Martinez JL (2004) Gibberellins repress photomorphogenesis in darkness. Plant Physiol 134:1050–1057.</ref>
 +
<ref name="ref7">Kaneko M, Itoh H, Inukai Y, Sakamoto T, Ueguchi-Tanaka M, Ashikari M, Matsuoka M (2003) Where do gibberellin biosynthesis and gibberellin signalling occur in rice plants? Plant J 35:104–115.</ref>
 +
</references>
  
 
==Structured Information==
 
==Structured Information==

Revision as of 08:47, 10 June 2014

Please input one-sentence summary here.

Annotated Information

Function

Oshox4 belongs to the homeodomain leucine zipper (HD-Zip) genes that encode transcription factors that contain conserved DNA motif called the homeobox[1]. There are four family members in HD-Zip including I, I, II, III and IV [2], and Oshox4 which locates in chromosome 9 belongs to HD-Zip I. In addition, it is suggested that all HD-Zip I and II proteins family members can form homodimers and also heterodimers[3].

Expression

Oshox4 expresses in leaf primordial of shoot apex, and in young leaves without polar distribution (Fig. 2A, a,b), even though being enhanced in upper and lower epidermis and vascular bundles surrounding cells. In addition, from floral meristems, floral organ primordia and the embryonic axis, we can detect Oshox4 mRNA (Fig. 2A, c–e). Oshox4 expresses more in drought resistant than in drought-sensitive rice cultivars [1]. To understand the subcellular localization of Oshox4, researchers fused Oshox4 with enhanced green fluorescence protein to produce recombinant proteins at the downstream of cauliflower mosaic virus (CaMV) 35S promoter and introduced into the onion cells. The confocal microscopy pictures show that fusion protein was localized in the nuclei of the onion cells [4](Fig. 2B).

Evolution

Please input evolution information here.

Subcellular localization

To understand the subcellular localization of Oshox4, researchers fused Oshox4 with enhanced green fluorescence protein to produce recombinant proteins at the downstream of cauliflower mosaic virus (CaMV) 35S promoter and introduced into the onion cells. The confocal microscopy pictures show that fusion protein was localized in the nuclei of the onion cells [4](Fig. 2B).

Mutant

When Oshox4 is over expressed in more than 40 independent transgenic T0 plants, there are 27 semi-dwarf phenotype plants that possess only a half of the wild ones as well as two times tillers than the normal wild plants (Fig. 3A). This may due to the reduced transgenic plants cell elongation that occurs in epidermal, elongating and intercalary meristem cells compared to wild type. And Oshox4 may interact with the fragment corresponding to -1080 to-1662 from the initiation ATG codon of the YAB1. Further experiments show that these Oshox4-over-expression plants with semi-dwarf cannot be rescued by adding GA3 (Fig 5), but the mutant plants with semi-dwarf caused by YAB1-over-expression can rehabilitate to the same height of the wild type [5]. In Oshox4 over expressed mutants, both the GA metabolic gene expression and the amylase production change. At the same time, the GA upregulate the expression level of Oshox4[4]. Oshox4 knock-down plants by the expression of RNAi vector with a gene-specific segmet of Oshox4 show no significant changes, which may due to the function of other HD-Zip I in rice [4].

Considering the previous reports about Arabidopsis[6] and gibberellin biosynthesis [7] and other evidences, it is predicted that Oshox4 function in GA signaling.

Labs working on this gene

Please input related labs here.

References

  1. ↑ 1.0 1.1 Adamantia Agalou, Sigit Purwantomo, Elin O¨verna¨s et al. A genome-wide survey of HD-Zip genes in rice and analysis of drought-responsive family members Plant Mol Biol (2008) 66:87–103.
  2. ↑ Sessa G, Carabelli M, Ruberti I (1994) Identification of distinct families of HD-Zip proteins inArabidopsis thaliana. In: Coruzzi GP (ed) Plant molecular biology. Springer-Verlag, Berlin, pp 412–426.
  3. ↑ A. H. Meijer, R. J. de Kam, I. d'Erfurth, W. Shen, J. H. C. Hoge. HD-Zip proteins of families I and II from rice: interactions and functional properties. Molecular and General Genetics MGG, February 2000, Volume 263, Issue 1, pp 12-21.
  4. ↑ 4.0 4.1 4.2 4.3 Mingqiu Dai, Yongfeng Hu, Qian Ma, Yu Zhao, Dao-Xiu Zhou. Functional analysis of rice HOMEOBOX4 (Oshox4) gene reveals a negative function in gibberellin responses. Plant Mol Biol (2008) 66:289–301.
  5. ↑ Dai M, Zhao Y, Ma Q, Hu Y, Hedden P, Zhang Q, Zhou DX (2007a) The rice YABBY1 gene is involved in the feedback regulation of gibberellin metabolism. Plant Physiol 144:121–133.
  6. ↑ Alabadi D, Gil J, Blazquez MA, Garcia-Martinez JL (2004) Gibberellins repress photomorphogenesis in darkness. Plant Physiol 134:1050–1057.
  7. ↑ Kaneko M, Itoh H, Inukai Y, Sakamoto T, Ueguchi-Tanaka M, Ashikari M, Matsuoka M (2003) Where do gibberellin biosynthesis and gibberellin signalling occur in rice plants? Plant J 35:104–115.

Structured Information

Gene Name

Os09g0470500

Description

Homeodomain leucine zipper protein

Version

NM_001069971.1 GI:115479684 GeneID:4347333

Length

1716 bp

Definition

Oryza sativa Japonica Group Os09g0470500, complete gene.

Source

Oryza sativa Japonica Group 

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:18556879..18558594

Sequence Coding Region

18557207..18557276,18557394..18557740,18557867..18558283

Expression

GEO Profiles:Os09g0470500

Genome Context

<gbrowseImage1> name=NC_008402:18556879..18558594 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:18556879..18558594 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaagcgacccggcggtgccggcggcggcggaggcagcccatcgctcgtcacgatggctaattctagtgatgatggatatggaggggttgggatggaggcggagggggacgtggaggaggagatgatggcgtgcggcggcggcggggagaagaagcggcggctgagcgtggagcaggttcgcgcgctggagcggagcttcgaggtggagaacaagcttgagcctgagcggaaggcgcggctggcgcgcgacctcggcctgcagccgcgccaggtcgccgtctggttccagaaccgccgcgcgcggtggaagaccaagcagctcgagcgcgactacgccgcgctccgccattcctacgactccctgcgcctcgatcacgacgcgctccgccgcgacaaggacgccctcctcgccgagatcaaggagctgaaggcgaagctcggggacgaggaggcggcggcgagcttcacgtcggtgaaggaggagccggcggcctccgacgggccaccggcggcgggatttgggtcgtccgacagcgactcaagcgcggtgctgaacgacgtggacgcggccggcgccgcgcccgcggcgacggacgcgctggctccggaggcgtgcacgtttctcggcgcgccgcccgccgcgggcgcgggcgcgggcgcagcggcggcggcgagccacgaggaggtgttcttccacggcaatttcctcaaggtggaggaggacgagacggggttcctcgacgacgacgagccgtgcggcgggttcttcgccgacgatcagcccccgccgctgtcgtcgtggtgggccgagcccacggagcactggaactga</cdnaseq>

Protein Sequence

<aaseq>MKRPGGAGGGGGSPSLVTMANSSDDGYGGVGMEAEGDVEEEMMA CGGGGEKKRRLSVEQVRALERSFEVENKLEPERKARLARDLGLQPRQVAVWFQNRRAR WKTKQLERDYAALRHSYDSLRLDHDALRRDKDALLAEIKELKAKLGDEEAAASFTSVK EEPAASDGPPAAGFGSSDSDSSAVLNDVDAAGAAPAATDALAPEACTFLGAPPAAGAG AGAAAAASHEEVFFHGNFLKVEEDETGFLDDDEPCGGFFADDQPPPLSSWWAEPTEHW N</aaseq>

Gene Sequence

<dnaseqindica>329..398#516..862#989..1405#gaaaacagaaaggaaaccgagaaagagagagagagagagagaggtagggagggaagaagagtcactccacactccacactctcatcccctggtccctttcttggatcatgagaaaccgcgcaacaaaattgcaattctaggcagcatttggaccggggacttggctacgtggtgtttggccatggatcgcagcgtggaattaagaccggcgaggactcagcgacggaggcacccgcgtcattcctacgcttctgtgcccgtcgtcttctcgcagtgagagagagagagagatcgaccaggcgttcactgaattttactagaactcggcatgaagcgacccggcggtgccggcggcggcggaggcagcccatcgctcgtcacgatggctaattctagtggtaatctttgttctttggttttccttttgtggcaattcattctttggaggtgatggtgtagtgtgatatgtgcgggaaattgagtgttttgtaattgtacatgcgtgttttgattagatgatggatatggaggggttgggatggaggcggagggggacgtggaggaggagatgatggcgtgcggcggcggcggggagaagaagcggcggctgagcgtggagcaggttcgcgcgctggagcggagcttcgaggtggagaacaagcttgagcctgagcggaaggcgcggctggcgcgcgacctcggcctgcagccgcgccaggtcgccgtctggttccagaaccgccgcgcgcggtggaagaccaagcagctcgagcgcgactacgccgcgctccgccattcctacgactccctgcgcctcgatcacgacgcgctccgccgcgacaaggacgccctcctcgccgaggtacgtgccgactgagtcgctgccctgccgtgccgcctgagctgttgctctgcgtgactgcgtcgagcagtcgttcgtttgcgcgcataatgtctgatggcttcttggtcgcgcgaattgtggcagatcaaggagctgaaggcgaagctcggggacgaggaggcggcggcgagcttcacgtcggtgaaggaggagccggcggcctccgacgggccaccggcggcgggatttgggtcgtccgacagcgactcaagcgcggtgctgaacgacgtggacgcggccggcgccgcgcccgcggcgacggacgcgctggctccggaggcgtgcacgtttctcggcgcgccgcccgccgcgggcgcgggcgcgggcgcagcggcggcggcgagccacgaggaggtgttcttccacggcaatttcctcaaggtggaggaggacgagacggggttcctcgacgacgacgagccgtgcggcgggttcttcgccgacgatcagcccccgccgctgtcgtcgtggtgggccgagcccacggagcactggaactgaagcaaatccggcgtaaccgcagccgagagagagagttggaaaacactatgcctgggggaataaagaattctgcaggaaagcagggtcttatctgcaattttgtaaaaaaaatggacctctacgtacttctctagtctcttttgccaattctcgcgcacattagctgtagcactgcagtgtagtaaaatcctactactccattacctctccaatttctagctctcacttccctacttaaactcatctgagctctaatgtaagcatatgccatccaaaatggaccataaatatgtcactagcagtaggatggt</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0470500, RefSeq:Os09g0470500

Retrieved from "https://ngdc.cncb.ac.cn/ricewiki/index.php?title=Os09g0470500&oldid=183432"