Difference between revisions of "Os01g0750100"
m |
m |
||
| Line 1: | Line 1: | ||
Please input one-sentence summary here. | Please input one-sentence summary here. | ||
| − | + | OsWRKY13 is a gene that plays a pivotal role in disease resistance. | |
==Annotated Information== | ==Annotated Information== | ||
===Function=== | ===Function=== | ||
| Line 21: | Line 21: | ||
[3]Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice.Deyun Qiu; Jun Xiao; Weibo Xie; Hongtao Cheng; Xianghua Li; Shiping Wang BMC Plant Biology, 2009, 9(1): 74 DOI: 10.1186/1471-2229-9-74. | [3]Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice.Deyun Qiu; Jun Xiao; Weibo Xie; Hongtao Cheng; Xianghua Li; Shiping Wang BMC Plant Biology, 2009, 9(1): 74 DOI: 10.1186/1471-2229-9-74. | ||
[4]Annotations and Functional Analyses of the Rice WRKY Gene Superfamily Reveal Positive and Negative Regulators of Abscisic Acid Signaling in Aleurone Cells. | [4]Annotations and Functional Analyses of the Rice WRKY Gene Superfamily Reveal Positive and Negative Regulators of Abscisic Acid Signaling in Aleurone Cells. | ||
| − | Zhen Xie, Zhong-Lin Zhang, Xiaolu Zou, Jie Huang, Paul Ruas, Daniel Thompson, Qingxi J. Shen Plant Physiology, 2005, 137(1): 176-189 DOI: 10.1104/pp.104.054312 | + | Zhen Xie, Zhong-Lin Zhang, Xiaolu Zou, Jie Huang, Paul Ruas, Daniel Thompson, Qingxi J. Shen Plant Physiology, 2005, 137(1): 176-189 DOI: 10.1104/pp.104.054312 |
| + | [5]Identification of novel pathogen-responsive cis-elements and their binding proteins in the promoter of OsWRKY13, a gene regulating rice disease resistance. MENG CAI, DEYUN QIU, TING YUAN, XINHUA DING, HONGJING LI, LIU DUAN, CAIGUO XU, XIANGHUA LI, SHIPING WANG Plant, Cell & Environment, 2008, 31(1): 86-96 DOI:10.1111/j.1365-3040.2007.01739.x.[6]OsWRKY13 Mediates Rice Disease Resistance by Regulating Defense-Related Genes in Salicylate- and Jasmonate-Dependent Signaling Deyun Qiu; Jun Xiao; Xinhua Ding; Min Xiong; Meng Cai; Yinglong Cao; Xianghua Li; Caiguo Xu; Shiping Wang Molecular Plant-Microbe Interactions, 2007, 20(5): 492-499 DOI: 10.1094/MPMI-20-5-0492. | ||
==Structured Information== | ==Structured Information== | ||
| + | |||
{{JaponicaGene| | {{JaponicaGene| | ||
GeneName = Os01g0750100| | GeneName = Os01g0750100| | ||
Revision as of 10:00, 10 June 2014
Please input one-sentence summary here. OsWRKY13 is a gene that plays a pivotal role in disease resistance.
Contents
Annotated Information
Function
OsWRKY13 is a gene that plays a pivotal role in disease resistance against bacterial and fungal pathogens.OsWRKY13 directly or indirectly regulates the expression of more than 500 genes that are potentially involved in different physiologic processes according to the classification of the Gene Ontology database.OsWRKY13 is also a regulator of other physiologic processes during pathogen infection. This overexpression was accompanied by the activation of salicylic acid (SA) synthesis-related genes and SA-responsive genes and the suppression of jasmonic acid (JA) synthesis-related genes and JA-responsive genes.
Expression
OsWRKY13 bound to the promoters of its own and at least three other genes in SA- and JA-dependent signaling pathways. Its DNA-binding activity was influenced by pathogen infection. These results suggest that OsWRKY13, as an activator of the SA-dependent pathway and a suppressor of JA-dependent pathways, mediates rice resistance by directly or indirectly regulating the expression of a subset of genes acting both upstream and downstream of SA and JA
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1National Key Laboratory of Crop Genetic Improvement, National Center of Plant Gene Research (Wuhan), Huazhong Agricultural University
References
[1]The WRKY Gene Family in Rice .Christian A. Ross, Yue Liu, Qingxi J. Shen Journal of Integrative Plant Biology, 2007, 49(6): 827-842 DOI: 10.1111/j.1744-7909.2007.00504.x [2]Rice Gene Network Inferred from Expression Profiling of Plants Overexpressing OsWRKY13, a Positive Regulator of Disease Resistance.Deyun Qiu, Jun Xiao, Weibo Xie, Hongbo Liu, Xianghua Li, Lizhong Xiong, Shiping Wang .Molecular Plant, 2008, 1(3): 538-551 DOI: 10.1093/mp/ssn012. [3]Exploring transcriptional signalling mediated by OsWRKY13, a potential regulator of multiple physiological processes in rice.Deyun Qiu; Jun Xiao; Weibo Xie; Hongtao Cheng; Xianghua Li; Shiping Wang BMC Plant Biology, 2009, 9(1): 74 DOI: 10.1186/1471-2229-9-74. [4]Annotations and Functional Analyses of the Rice WRKY Gene Superfamily Reveal Positive and Negative Regulators of Abscisic Acid Signaling in Aleurone Cells. Zhen Xie, Zhong-Lin Zhang, Xiaolu Zou, Jie Huang, Paul Ruas, Daniel Thompson, Qingxi J. Shen Plant Physiology, 2005, 137(1): 176-189 DOI: 10.1104/pp.104.054312 [5]Identification of novel pathogen-responsive cis-elements and their binding proteins in the promoter of OsWRKY13, a gene regulating rice disease resistance. MENG CAI, DEYUN QIU, TING YUAN, XINHUA DING, HONGJING LI, LIU DUAN, CAIGUO XU, XIANGHUA LI, SHIPING WANG Plant, Cell & Environment, 2008, 31(1): 86-96 DOI:10.1111/j.1365-3040.2007.01739.x.[6]OsWRKY13 Mediates Rice Disease Resistance by Regulating Defense-Related Genes in Salicylate- and Jasmonate-Dependent Signaling Deyun Qiu; Jun Xiao; Xinhua Ding; Min Xiong; Meng Cai; Yinglong Cao; Xianghua Li; Caiguo Xu; Shiping Wang Molecular Plant-Microbe Interactions, 2007, 20(5): 492-499 DOI: 10.1094/MPMI-20-5-0492.
Structured Information
| Gene Name |
Os01g0750100 |
|---|---|
| Description |
Similar to WRKY transcription factor-like (WRKY transcription factor 13) (WRKY13) |
| Version |
NM_001050786.1 GI:115439942 GeneID:4324624 |
| Length |
1605 bp |
| Definition |
Oryza sativa Japonica Group Os01g0750100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:33164978..33166582 |
| Sequence Coding Region |
33165534..33165549,33165618..33165719,33165869..33166018,33166114..33166316 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:33164978..33166582 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:33164978..33166582 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcggccggagaggaggtgatggatcggtcgacgtcggccgaggacgggtactgcagcgccggcacggactcgccgcgggcggagtccgtcgacgagcaaggggccgccgaggagtcgtcgccccggggagggcagaagcgggagctcccctcgccgtcggcttcgccgtcgtccccgctgccacctgccgcgaagcgcagccggaggtcagtggagaagcgggtggtgtccgtgccgatcgcggagtgcggcgaccggccgaagggcgccggggaggggccgccgccgtcggactcgtgggcctggcgcaagtacggccagaagcccatcaagggctctccctacccaagggggtactacaggtgcagtagctccaaggggtgtccggcgaggaagcaggtggagcgcagccgcgccgaccccaccgtgctgctcgtcacctactccttcgacggcgccaaagcctga</cdnaseq> |
| Protein Sequence |
<aaseq>MAAGEEVMDRSTSAEDGYCSAGTDSPRAESVDEQGAAEESSPRG GQKRELPSPSASPSSPLPPAAKRSRRSVEKRVVSVPIAECGDRPKGAGEGPPPSDSWA WRKYGQKPIKGSPYPRGYYRCSSSKGCPARKQVERSRADPTVLLVTYSFDGAKA</aaseq> |
| Gene Sequence |
<dnaseqindica>1034..1049#864..965#565..714#267..469#tttccatcccctccatcatgagctccaattagccgcacaccgatcccctcctcttcttcccccccttctcctctctcctctttttttcctcatccgtgcgcgatactgcgcttagtttgtgggtggggggagtgatcatcaccaaagccacaaagggggcgcggagagatattatatattctttgggaaagcgttggattagtttttctcgctttgggctttttatccggagttggagtgtgtgtgcgccgggagtggtggtggtgatggcggccggagaggaggtgatggatcggtcgacgtcggccgaggacgggtactgcagcgccggcacggactcgccgcgggcggagtccgtcgacgagcaaggggccgccgaggagtcgtcgccccggggagggcagaagcgggagctcccctcgccgtcggcttcgccgtcgtccccgctgccacctgccgcgaagcgcaggtacggataatattatggctcggtctgcgattgattaaagccctaggtaggatttagggatagaggattgattggtgtttggttggtttgagcagccggaggtcagtggagaagcgggtggtgtccgtgccgatcgcggagtgcggcgaccggccgaagggcgccggggaggggccgccgccgtcggactcgtgggcctggcgcaagtacggccagaagcccatcaagggctctccctacccaaggtaattaggctttatattcagtttggttgatattcttgagcctgttgattagttaccgtgctgattaatcactgcaattagatcagttaaacggttgttgaagtggcaagatttaatttgggtttgttgcttgtgtttattatgctcagggggtactacaggtgcagtagctccaaggggtgtccggcgaggaagcaggtggagcgcagccgcgccgaccccaccgtgctgctcgtcacctactccttcgagcacaaccacccgtggccgcagcccaagagcagcagctgccacgcgagcaagtcgtctccccggtcgacggcgccaaagcctgagccggtggctgacggacagcaccccgagccagcggagaacgaatcgtcggcgtcggcggagctggaggtaccggagccggagccggagcaggaatctgagccggttgtgaagcaggaggaggagcagaaggaggaacagaaggctgtggttgagccggcggcggtcacaaccacggtggcgccggcgccggcggtcgaggaggaggatgagaacttcgacttcggatggatcgaccagtaccacccgacgtggcaccggtcgtacgcgccgctgctgccgccggaggagtgggagcgcgagctgcaaggggacgacgcgctgttcgcggggctcggcgagctcccggagtgcgccgtcgtgttcggccgccggcgcgagctcggcctggcggccaccgcgccgtgctcctgatgatcacctcctcttttctttttcctccccttttacaatttcccttttttttttttgcttttctttagttctccttggagtaatttggattggaggttagtacatagcttgggtgatcaatgggagtgagtggcttaactgttc</dnaseqindica> |
| External Link(s) |